Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: August 5480
Next month in: 00:42:21
Server time: 23:17:38, May 08, 2024 CET
Currently online (3): dnobb | Tayes_Gad | wstodden2 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Malivia Liberals[?]

This page contains information about the Malivia Liberals.

This party is inactive.

Details

User[?]: Saxmusicboy

Nation[?]: Republic of Malivia / Malivia Prajatantra Gantantra (Malivia)

Seats[?] in Maliviyan Legislative Assembly or Malvian People's Free Congress or Pratinidhi Sabha[?]: 0

Color[?]:

 

Description[?]:

Need a voice in a Democracy world. The Malivia Liberals, will stand up for your most beloved rights and needs! Vote Malivia Liberals TODAY! We need you.

Started in 2157 in Malivia by voters who needed a vocie in a unseen government.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate federalistmoderateperfect
Civil Rightsrestrictive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalistlimitedperfect
Government Responsibilitiesmoderate small governmentmoderateperfect
Marketregulator-leaningmoderateperfect
Militarypacifist-leaningmoderateperfect
Moralitymoderate progressivelimitedperfect
Religionmoderate secularlimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
October 2157038,257,6200.00+0.0004990.00+0
October 21594,961,92338,468,26512.90+12.906549913.03+65
October 21614,597,40436,214,37312.69-0.206349912.63-2
October 21637,225,31836,775,42119.65+6.9510049920.04+37
October 21656,313,52337,614,82716.78-2.868449916.83-16
October 21678,271,68636,332,29822.77+5.9811449922.85+30
October 21716,753,86335,553,60719.00-3.7711359918.86-1
October 21747,506,77634,705,05221.63+2.6313059921.70+17
October 21777,614,51840,519,52218.79-2.845829919.40-72
January 222610,426,48248,270,94421.60+2.816530121.59+7
January 22297,294,83046,873,51015.56-6.044930116.28-16
September 22297,471,46644,227,34716.89+1.335130116.94+2
December 223110,000,47939,342,13025.42+8.537930126.25+28
April 22348,119,27541,244,87819.69-5.736030119.93-19
April 22377,085,84942,715,09916.59-3.105130116.94-9
April 22407,194,66441,400,27617.38+0.795630118.60+5
April 22437,374,65541,231,14617.89+0.515630118.60+0
April 22468,459,64341,606,96820.33+2.456230120.60+6

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Malivia Liberals.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413

BillCreatedVoting startedVoteBill StatusResult
Gambling And GovernmentSeptember 2428February 2429passed
Military Priority BillSeptember 2428January 2429defeated
Prostitution LawsAugust 2428February 2429passed
Foreign InvestmentsAugust 2428February 2429defeated
Coalition CabinetsAugust 2428February 2429defeated
Democratic Workers' CouncilsAugust 2428February 2429defeated
Local Authority BillAugust 2428February 2429defeated
Identification Cards For CitizensAugust 2428February 2429defeated
Adoption BillAugust 2428November 2428defeated
Intelligence AgencyAugust 2428November 2428defeated
Genetically Modified PlantsAugust 2428November 2428defeated
Waste Disposal BillAugust 2428November 2428defeated
Private Cars BillAugust 2428November 2428defeated
Licensing of Food SalesAugust 2428November 2428defeated
Maximum Proposal BillAugust 2428November 2428defeated
Eminent Domain BillMay 2428April 2429defeated
Local Militias ActMay 2428February 2429defeated
Ending Child LaborMay 2428February 2429passed
Agriculture BillMay 2428November 2428passed
Amendment of the JawatankuasaMay 2428November 2428defeated

Random fact: In Particracy players are only allowed to play as one party at a time. Want to swap nations? Inactivate your current party and make a new one! Want to return? Request Moderation to reactivate your party on the forum!

Random quote: "Never doubt that a small group of thoughtful, committed citizens can change the world. Indeed, it is the only thing that ever has." - Margaret Mead

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51