Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: July 5476
Next month in: 00:48:48
Server time: 19:11:11, April 28, 2024 CET
Currently online (3): DanivonX | GLNBei | SocDemDundorfian | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Heijtri Prta[?]

This page contains information about the Heijtri Prta.

This party is inactive.

Details

User[?]: Juicy7

Nation[?]: Pontesi Hanrapetut’yun (Pontesi)

Seats[?] in Պոնտեսիայի Ազգային ժողով (National Assembly of Pontesi)[?]: 0

Color[?]:

 

Description[?]:

Pnték: Heijtri Prta
Luthorian: Eagle Party

Leader: Mrjkai Trisrl (since July 3660)
Founded: July 3660
Ideology:
Position:

General statement

Economic/social

General

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningexcellentperfect
Civil Rightsrestrictive-leaningexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaningclose to noneperfect
Government Responsibilitiesmoderate big governmentexcellentperfect
Marketregulator-leaningexcellentperfect
Militarypacifist-leaningexcellentperfect
Moralitymoderate conservativehighperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
July 36607,338,26615,144,16148.46+48.4611523548.94+115

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Heijtri Prta.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330

BillCreatedVoting startedVoteBill StatusResult
Foreign Investment Liberalisation ActAugust 4175August 4175defeated
Social Conservatism For Pontesi!August 4175August 4175defeated
Cabinet Proposal of May 4175May 4175May 4175defeated
Equal RepresentationMay 4175May 4175defeated
Bill to Facilitate the Respective Positions of the Partium Nos and Pontesi Peoples PartyMay 4175May 4175defeated
Pontesi Peoples Party OmnibusMay 4175May 4175defeated
aJanuary 4175January 4175defeated
Call for early elections, January 4175January 4175January 4175defeated
abortionDecember 4174December 4174passed
Change in the title of the houseNovember 4174February 4175defeated
New FlagNovember 4174November 4174defeated
Forestry and Industries ActNovember 4174November 4174defeated
.November 4174November 4174defeated
Change in Title Of the Head of GovernmentNovember 4174November 4174defeated
ChangesOctober 4174October 4174defeated
Nuclear Energy ActAugust 4174August 4174passed
Eminent Domain ActAugust 4174August 4174passed
Space Exploration Regulation ActAugust 4174August 4174passed
Religion ActAugust 4174August 4174passed
Budget proposal of July 4174July 4174July 4174defeated

Random fact: By default the head of government is the ultimate authority within a national government. In general terms, heads of government are expected to consult with cabinet colleagues (including those from other parties) before making significant decisions but they remain responsible for government action.

Random quote: "I worked at a factory owned by Germans, at coal pits owned by Frenchmen, and at a chemical plant owned by Belgians. There I discovered something about capitalists. They are all alike, whatever the nationality. All they wanted from me was the most work for the least money that kept me alive. So I became a communist." - Nikita Khrushchev

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51