Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5475
Next month in: 03:55:06
Server time: 04:04:53, April 27, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Factio Republicana Socialistica[?]

This page contains information about the Factio Republicana Socialistica.

This party is inactive.

Details

User[?]: Bacchus

Nation[?]: Principatus Selucianus (Selucia)

Seats[?] in Senātus Populī[?]: 0

Color[?]:

 

Description[?]:

The Socialist Republican Party is a left-wing political party in Selucia that seeks to restore the Republic. The Socialist Republican Party represents the left wing of Selucian republicanism, and seeks to establish a participative economic democracy.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsextreme permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiesbig government-leaningmoderateperfect
Marketmoderate regulatorlimitedperfect
Militarymoderate militaristlimitedperfect
Moralityprogressive-leaninglimitedperfect
Religionmoderate secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
February 382114,182,96959,074,72824.01+24.0116970024.14+169
February 382616,487,88659,590,36127.67+3.6611240127.93-57
March 382723,529,01261,168,42738.47+10.8015540138.65+43
March 383215,360,99036,861,27241.67+3.2117140142.64+16
March 38378,419,30635,173,56823.94-17.749740124.19-74
March 38424,820,47434,496,26813.97-9.965640113.97-41
March 38475,040,17049,033,18510.28-3.69404019.98-16
March 38526,889,40565,676,29410.49+0.214240110.47+2
March 38538,087,17462,765,77812.88+2.395140112.72+9
March 38555,341,07352,907,69910.10-2.79404019.98-11
July 38558,918,70858,816,15115.16+5.075940114.71+19
April 385810,505,84757,691,96618.21+3.057340118.20+14
April 38618,517,16749,100,54017.35-0.867340118.20+0
January 397926,669,86051,861,26051.43+34.0833265051.08+259
November 437010,431,68661,316,20817.01-34.4113175017.47-201
November 43749,604,05862,989,58815.25-1.7711675015.47-15
November 43788,310,06260,141,92213.82-1.4310675014.13-10
November 43825,200,67462,505,5038.32-5.50617508.13-45
November 43866,127,26563,867,2819.59+1.27717509.47+10
October 43876,852,00863,048,23310.87+1.278175010.80+10
October 43916,855,44464,804,06110.58-0.297875010.40-3
April 439411,155,12861,952,11618.01+7.4313675018.13+58
April 439811,147,22965,450,38417.03-0.9713075017.33-6
April 44027,921,08462,796,39212.61-4.429675012.80-34
April 44067,079,83861,938,62811.43-1.188875011.73-8
April 44077,571,06957,551,26413.16+1.7210375013.73+15
April 441115,334,56157,335,23526.75+13.5920075026.67+97
April 44159,880,66859,378,77216.64-10.1112475016.53-76
April 44195,933,27761,024,2689.72-6.92747509.87-50
November 44206,314,08164,669,0049.76+0.04737509.73-1
November 442412,907,88360,618,18721.29+11.5316275021.60+89
September 442514,432,96557,736,03225.00+3.7018975025.20+27
August 442623,542,24452,721,89444.65+19.6633175044.13+142
August 443014,945,55757,121,02926.16-18.4919675026.13-135
August 443418,209,35956,334,39632.32+6.1624575032.67+49
March 443523,838,90953,879,35944.24+11.9233275044.27+87
November 443727,030,65054,284,25149.79+5.5537075049.33+38
November 444125,667,89752,209,35449.16-0.6336575048.67-5
November 444526,076,41851,515,01350.62+1.4637975050.53+14
November 444926,145,82150,031,16852.26+1.6439375052.40+14
November 445325,634,19649,675,39651.60-0.6638675051.47-7
November 445724,684,32048,076,11251.34-0.2638275050.93-4
November 446128,537,93461,969,36446.05-5.2934575046.00-37
November 446526,749,98160,756,62744.03-2.0232975043.87-16
November 446923,679,17761,150,41438.72-5.3128175037.47-48
November 447314,058,99366,017,81421.30-17.4315975021.20-122
September 447616,665,83163,130,81526.40+5.1019975026.53+40
July 447815,578,07954,642,10328.51+2.1121775028.93+18
July 448213,711,58464,631,29421.22-7.2916075021.33-57
February 448322,722,65558,283,72138.99+17.7728975038.53+129
February 448720,647,28557,989,59035.61-3.3826275034.93-27
February 449118,565,66060,795,76630.54-5.0722475029.87-38
March 449118,510,25157,163,63932.38+1.8424375032.40+19
March 449523,033,04563,253,41636.41+4.0327475036.53+31
March 449922,500,87659,719,29637.68+1.2628075037.33+6
March 450321,610,49463,785,87433.88-3.8025275033.60-28
March 450720,896,99151,895,93940.27+6.3929175038.80+39
March 451120,746,59951,967,32539.92-0.3430275040.27+11
March 451523,966,09955,728,35143.01+3.0832575043.33+23
March 451923,636,61653,788,43543.94+0.9433175044.13+6
February 45225,826,08234,482,06616.90-27.0513375017.73-198
February 452631,224,47361,340,48150.90+34.0138175050.80+248
February 453027,474,99462,093,92244.25-6.6633375044.40-48
February 453429,884,88361,586,33248.53+4.2836475048.53+31
February 453812,818,04261,805,50420.74-27.7915575020.67-209
April 45418,358,02660,694,23913.77-6.9710375013.73-52
April 454516,396,93460,960,54626.90+13.1320475027.20+101
September 454625,527,15856,560,43545.13+18.2334275045.60+138
September 455027,552,32554,558,19650.50+5.3738175050.80+39
November 479212,020,70112,020,701100.00+49.50300300100.00-81
November 479711,702,92711,702,927100.00+0.00750750100.00+450
November 48027,174,42052,045,79113.78-86.2210875014.40-642
November 480733,258,12463,602,54352.29+38.5139375052.40+285
November 481232,207,55564,297,97050.09-2.2037875050.40-15
November 481731,282,28264,411,35848.57-1.5236575048.67-13
November 482231,097,34363,641,08248.86+0.3036975049.20+4
November 482722,423,42554,894,37440.85-8.0230475040.53-65
November 483220,163,43354,102,50737.27-3.5828275037.60-22
November 483721,266,36555,516,87138.31+1.0429675039.47+14
November 484221,067,81856,798,55537.09-1.2128175037.47-15
November 484727,099,96253,251,22150.89+13.8037975050.53+98
November 485221,911,21544,343,50449.41-1.4837675050.13-3
November 485720,904,66742,318,02649.40-0.0137775050.27+1
November 486218,542,47352,405,56035.38-14.0226175034.80-116
November 486728,872,72350,022,21657.72+22.3443175057.47+170
November 487224,857,83945,760,71154.32-3.4040875054.40-23
November 487724,142,52346,225,77452.23-2.0938975051.87-19
November 488215,883,57852,409,30830.31-21.9222975030.53-160
May 502311,095,98311,128,21499.71+69.40750750100.00+521
May 502512,343,94712,343,947100.00+0.29750750100.00+0
May 502711,953,44711,953,447100.00+0.00750750100.00+0
May 502911,434,82011,434,820100.00+0.00750750100.00+0
March 510311,734,07911,734,079100.00+0.00750750100.00+0
May 510411,606,74511,606,745100.00+0.00750750100.00+0
January 511011,828,90511,828,905100.00+0.00750750100.00+0
January 511511,698,42911,698,429100.00+0.007575100.00-675
January 512012,103,59812,139,59899.70-0.307575100.00+0
January 512512,271,94812,271,948100.00+0.307575100.00+0
January 513011,995,52611,995,526100.00+0.007575100.00+0

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Factio Republicana Socialistica.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471

BillCreatedVoting startedVoteBill StatusResult
Equality Act 2493January 2493January 2493passed
Passport Act 2492July 2492July 2492passed
Freedom of Expression 2492July 2492July 2492passed
Freedom of Family 2492July 2492July 2492passed
Home Schooling Connection 2492July 2492July 2492defeated
Illegal Immigration Act 2942July 2492July 2492passed
Curfew Removal Act 2942July 2492July 2492passed
Union Strike Action Act 2942July 2492July 2492passed
Smoking Regulations Act 2492July 2492July 2492passed
[L&J] Income tax proposal /May2492/April 2492May 2492passed
[L&J] Education Bill /May2492/January 2492May 2492passed
Ending Welfare ActAugust 2491August 2491defeated
New National SportJanuary 2490February 2490defeated
Weapon ConcealmentDecember 2489December 2489defeated
The government's policy regarding foreign investmentsDecember 2489December 2489defeated
Prostitution Decided By Local Gov'tOctober 2489October 2489defeated
Public Transport BillAugust 2489September 2489defeated
Eminent Domain ActAugust 2489August 2489defeated
National Flag ActJuly 2489July 2489passed
Open Nation ActJuly 2489July 2489passed

Random fact: Treaties will be eligible for deletion if they are more than 50 in-game years old and have no currently ratified members.

Random quote: "And I said on my program, if, if the Americans go in and overthrow Saddam Hussein and it's clean, he has nothing, I will apologize to the nation, and I will not trust the Bush Administration again." - Bill O'Reilly

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51