Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: May 5477
Next month in: 00:34:39
Server time: 19:25:20, April 30, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Magni Iucunda Imperialium[?]

This page contains information about the Magni Iucunda Imperialium.

This party is inactive.

Details

User[?]: Robh

Nation[?]: Principatus Selucianus (Selucia)

Seats[?] in Senātus Populī[?]: 0

Color[?]:

 

Description[?]:

>><< Magni Iucunda Imperialium >><<

Magni Iucunda Imperialium (Great Pleasant Empire) is all about maintaining and increasing the greatness of the Selucian Empire, but in a pleasant and nice way.

---
Signed by head of MII
Flavius Augustus Aquilinus

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsrestrictive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistmoderateperfect
Government Responsibilitiesbig government-leaninghighperfect
Marketmoderate regulatorhighperfect
Militarymoderate pacifisthighperfect
Moralitymoderate progressivehighperfect
Religionsecular-leaninghighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
February 41317,473,87465,055,69711.49+11.498475011.20+84
February 41354,708,41562,235,1297.57-3.92577507.60-27
February 413923,956,30555,328,15843.30+35.7331675042.13+259
February 414318,506,36964,566,98628.66-14.6421675028.80-100
February 414720,036,46265,797,12930.45+1.7922875030.40+12
February 415119,640,95664,212,53830.59+0.1423175030.80+3
February 415516,968,90164,114,06226.47-4.1219875026.40-33
February 41596,924,01357,282,62512.09-14.388675011.47-112
February 41634,222,43058,593,6277.21-4.88537507.07-33
March 41665,929,97959,983,4509.89+2.687575010.00+22

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Magni Iucunda Imperialium.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471

BillCreatedVoting startedVoteBill StatusResult
Call for early elections, October 2322October 2322February 2323defeated
Patter Proposal V (e)October 2322October 2322passed
Patter Proposal V (d)October 2322October 2322defeated
Patter Proposal V (c)October 2322October 2322defeated
Patter Proposal V (b)October 2322October 2322passed
VBS - Decent Management ActJuly 2322December 2323defeated
An Act to ensure Readiness and Preparedness (IPP)January 2322November 2322passed
IPS - Administration Act // 2321December 2321December 2323passed
Security and Stability Act (IPP)October 2321November 2322passed
New NRP ProposalsOctober 2321October 2322defeated
IPS - Border Control Act // 2321September 2321December 2323passed
IPS - Cosmetic Act // 2321September 2321December 2323passed
Patter Proposal V (a)May 2321November 2322defeated
IPS - Eminent Domain Act // 2320December 2320February 2322defeated
IPS -Pre-School Education. Act // 2320December 2320December 2321defeated
IPS - Museum Act // 2320December 2320December 2321defeated
IPS - Withdraw 2December 2320September 2321defeated
An Act on the funding of Libraries, &c. (IPP)July 2320October 2321passed
An Act for preventing Tumults and riotous Assemblies, and for the more speedy and effectual punishing the Rioters (IPP)June 2320October 2321defeated
An Act to further protect Morality (IPP)June 2320October 2321defeated

Random fact: It is the collective responsibility of the players in a nation to ensure all currently binding RP laws are clearly outlined in an OOC reference bill in the "Bills under debate" section of the nation page. Confusion should not be created by displaying only some of the current RP laws or displaying RP laws which are no longer current.

Random quote: "The radical right is so homophobic that they're blaming global warming on the AIDS quilt." - Dennis Miller

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51