Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5479
Next month in: 00:53:54
Server time: 03:06:05, May 07, 2024 CET
Currently online (1): Kubrick2 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Alderdath Progrisati Lagaja[?]

This page contains information about the Alderdath Progrisati Lagaja.

This party is inactive.

Details

User[?]: Dead Flag

Nation[?]: Kundrati Union (Kundrati)

Seats[?] in Legebiltzarra/Národná rada (National Legislature)[?]: 0

Color[?]:

 

Description[?]:

The People's Progress Party stands for Unity, Solidarity and Equality.

We are anti-religion, anti-tradition and anti-capitalism.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristhighperfect
Civil Rightspermissive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaningmoderateperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketconvinced regulatormoderateperfect
Militarymilitarist-leaninglimitedperfect
Moralitymoderate progressivemoderateperfect
Religionmoderate secularhighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
November 241057,64786,627,9680.07+0.0703390.00+0
November 24139,822,77386,190,79311.40+11.333833911.21+38
November 24169,576,93280,025,65311.97+0.573833911.21+0
November 241915,849,31686,631,15918.30+6.336133917.99+23
November 24229,287,77782,780,40211.22-7.083733910.91-24
November 24259,266,12284,191,66411.01-0.213733910.91+0
November 242812,457,69881,153,91415.35+4.345233915.34+15
November 243111,147,29585,139,16213.09-2.264433912.98-8
April 243211,589,68184,210,22213.76+0.674633913.57+2
April 243510,094,69282,974,83212.17-1.604233912.39-4
April 243812,680,49986,148,68014.72+2.555133915.04+9
April 244113,084,45290,022,96714.53-0.185133915.04+0
September 248213,965,18689,375,56115.63+1.095333915.63+2
September 248514,102,43792,878,95515.18-0.445333915.63+0
September 248815,023,638102,651,92714.64-0.555033914.75-3
September 249115,119,305105,981,23014.27-0.374833914.16-2
September 249412,357,930106,442,00711.61-2.663833911.21-10
September 249715,401,478106,022,15614.53+2.924833914.16+10
September 250013,440,036105,904,04212.69-1.844433912.98-4
September 250313,636,138101,448,80813.44+0.754433912.98+0
September 250614,413,765100,933,37314.28+0.844833914.16+4
September 250920,315,917100,620,27420.19+5.916933920.35+21
September 251218,322,84994,641,46119.36-0.8313469919.17+65
September 251525,663,890103,246,71424.86+5.5017469924.89+40
September 251818,856,881106,902,89417.64-7.2212369917.60-51
September 252121,681,965106,464,36620.37+2.7314269920.31+19
September 252422,868,670105,105,86121.76+1.3915369921.89+11
September 252715,569,615118,838,61113.10-8.669069912.88-63
September 253017,323,996121,359,86614.27+1.179869914.02+8
September 253326,132,929119,531,87321.86+7.5915269921.75+54
September 253630,383,985118,852,33725.56+3.7018069925.75+28
September 253927,038,251123,227,25621.94-3.6215469922.03-26
September 254230,297,991126,453,61323.96+2.0216869924.03+14
September 254532,323,438125,869,60825.68+1.7218269926.04+14
September 254830,890,589126,681,94924.38-1.3017269924.61-10
September 255133,790,185122,957,31527.48+3.1019369927.61+21
September 255432,814,985112,063,67629.28+1.8020469929.18+11

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Alderdath Progrisati Lagaja.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346

BillCreatedVoting startedVoteBill StatusResult
Eminent Domain Compensation Act of 4029July 4029December 4029passed
End of Government Persecution Bill of 4029July 4029December 4029passed
SKSR Platform of 4029 (Ecology)July 4029July 4029defeated
SKSR Platform of 4028 (Agriculture)August 4028August 4028defeated
SKSR Platform of 4028 (Civil Liberties)August 4028August 4028defeated
SKSR Platform of 4028 (Foreign Policy)August 4028August 4028defeated
SKSR Platform of 4028 (Infrastructure)August 4028August 4028defeated
SKSR Platform of 4028 (Welfare)August 4028August 4028defeated
SKSR Platform of 4028 (Relgion)July 4028August 4028defeated
Addendum to Article 6 of the ConstitutionMarch 4027July 4028passed
Cabinet Proposal of February 4027February 4027March 4027passed
Fair Cabinet of 4027February 4027February 4027defeated
Working Hours Renegotiation Act of 4026September 4026March 4027passed
Public Access Media Act of 4026September 4026February 4027defeated
Public Health Act of 4026September 4026February 4027passed
Personal Smoking Act of 4026September 4026February 4027passed
Motherhood Safety Act of 4026September 4026February 4027passed
Healthcare Act of 4026September 4026February 4027passed
Education Act of 4026September 4026February 4027passed
Collective Ownership Act of 4026September 4026February 4027passed

Random fact: Once approved, players should copy Cultural Protocols into a bill in the debate section of their nation page, under the title of "OOC: Cultural Protocols". This bill should include links to the passed Cultural Protocol bill and the Moderation approval.

Random quote: "I reject the cynical view that politics is a dirty business." - Richard M. Nixon

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51