Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5492
Next month in: 00:33:17
Server time: 03:26:42, June 02, 2024 CET
Currently online (1): Razvedka | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Gaduridos Progressive Movement[?]

This page contains information about the Gaduridos Progressive Movement.

This party is inactive.

Details

User[?]: Jumpersmile

Nation[?]: República Gaduridana (Gaduridos)

Seats[?] in Congreso Nacional de la República de Gaduridos (National Congress of the Republic of Gaduridos)[?]: 0

Color[?]:

 

Description[?]:

We are a leftist party that support a strong national government and high taxes to pay for social programs.

Candidates for office
4295-4300* 4454*
President of the union: Acer Hawk
*Party went inactive in 4300 and failed to change candidates due to becoming active so close to the election.
*Other candidates were failed to be recorded.

4455-4479 -4474*
President of the Union: Wayan McGill
*Ministry of Head of Government: Alfonso Barbacia
Ministry of Foreign Affairs: Pierandrea Barbalini
Ministry of Internal Affairs: Guelfo Fiolo
Ministry of Finance: Zeba Jean
Ministry of Defence: Jase Chandler
Ministry of Justice: García de Medrano
Ministry of Infrastructure and Transport: Rodrigo de la Torre
Ministry of Health and Social Services: Antonio de Madrid
Ministry of Education and Culture: José de Tamayo
Ministry of Science and Technology: Meng Liuxian
Ministry of Food and Agriculture: Han Delan
Ministry of Environment and Tourism: Elizabeth Albani
Ministry of Trade and Industry: Castellana Carrillo
*On 4474 the Head of Government and President of the Union offices were combined.

4479-
President of the Union: Zeba Jean
Ministry of Head of Government: N/A
Ministry of Foreign Affairs: Gregory Little
Ministry of Internal Affairs: Jason Bowman
Ministry of Finance: Benjamin Martinez
Ministry of Defence: Kong Kun
Ministry of Justice: Stephanie Guerrero
Ministry of Infrastructure and Transport: Arthur Garcia
Ministry of Health and Social Services: Heidi Heitkamp
Ministry of Education and Culture: Amber Snyder
Ministry of Science and Technology: Madison Schultz
Ministry of Food and Agriculture: Teresa Mendez
Ministry of Environment and Tourism: Patricia Bruke
Ministry of Trade and Industry: Richard Baker

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristexcellentperfect
Civil Rightsmoderate permissiveexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistmoderateperfect
Government Responsibilitiessmall government-leaningexcellentperfect
Marketregulator-leaningexcellentperfect
Militarymoderate militaristhighperfect
Moralityconvinced progressivehighperfect
Religionmoderate secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
February 429718,672,39455,920,36733.39+33.3916650033.20+166
August 430021,553,05565,890,57232.71-0.6816550033.00-1
June 430231,594,56363,733,78949.57+16.8624850049.60+83
December 43057,916,46056,202,38014.09-35.497050014.00-178
November 44545,615,74565,304,8288.60-5.49283258.62-42
May 44556,917,92563,091,93410.96+2.373432510.46+6
June 445724,896,24754,760,49745.46+34.504510045.00+11
December 446018,740,53552,776,12435.51-9.953410034.00-11
March 446433,032,06661,495,04953.72+18.215410054.00+20
September 446724,650,47247,757,48151.62-2.105110051.00-3
May 446925,361,11446,598,87054.42+2.815310053.00+2
November 447232,573,51549,289,03166.09+11.666410064.00+11
December 447230,861,47547,781,04464.59-1.506310063.00-1
October 447341,583,21160,685,64468.52+3.937010070.00+7
June 447539,520,96164,472,02461.30-7.2230750061.40+237
June 447923,988,71665,703,68536.51-24.7918550037.00-122
June 448322,056,30462,328,97135.39-1.1217950035.80-6
June 448715,735,21261,862,27325.44-9.9512950025.80-50
June 449112,332,51662,906,52519.60-5.839850019.60-31

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Gaduridos Progressive Movement.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517

BillCreatedVoting startedVoteBill StatusResult
LGBT Rights ActMarch 4221June 4221passed
Call for early elections, March 4221March 4221May 4221defeated
Criminal Voting ReformNovember 4220November 4220defeated
Gaduridos First BillSeptember 4220September 4220defeated
Funding for abortionsNovember 4219November 4219passed
Eminent Domain ActNovember 4219November 4219passed
Public TransportNovember 4219November 4219defeated
Presidential CompromiseSeptember 4219September 4225defeated
Devolution of FireworksFebruary 4219February 4219passed
Ecology and Energy ActsNovember 4218September 4219defeated
Contraceptive ReformNovember 4218November 4218defeated
Call for early elections, April 4218April 4218April 4218defeated
Call for early elections, September 4217September 4217October 4217passed
The Socialist Party's ManifestoAugust 4217February 4229defeated
Fire Prevention ActApril 4217July 4225passed
Postal Service Regulation ActApril 4217September 4218passed
Public Transport Reform ActApril 4217September 4218defeated
Call for early elections, April 4217April 4217April 4217passed
Health DevolutionMarch 4217May 4218passed
Gadur Restoration ActJanuary 4217April 4218passed

Random fact: All role-play must respect the established cultural background in Culturally Protected nations.

Random quote: "A son can bear with equanimity the loss of his father, but the loss of his inheritance may drive him to despair." - Niccolo Machiavelli

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51