Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5492
Next month in: 01:04:51
Server time: 06:55:08, June 02, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Militant Revolutionary Armed Party (SI)[?]

This page contains information about the Militant Revolutionary Armed Party (SI).

This party is inactive.

Details

User[?]: Chairman Stephen

Nation[?]: Ikradonian Union (Ikradon)

Seats[?] in Federale Kamer (Federal Chamber)[?]: 0

Color[?]:

 

Description[?]:

The Militant Revolutionary Communist Party is led by I, Comrade Stephen, and my Party follows a Leninist-Trotskyist ideological line. We view the Party as the vanguard of the revolutionary proletariat and advocate/support Communist revolutions in all countries of Terra.

This Party shall be a vanguard against corruption, Stalinism, war, gay/lesbian oppression, xenophobia, poverty and especially capitalism!

All true Communists/ Socialists are welcome to join the Party.

Communism or death!

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationconvinced unitaristmoderateperfect
Civil Rightsmoderate restrictivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced isolationisthighperfect
Government Responsibilitiesmoderate big governmentexcellentperfect
Marketfanatical regulatorexcellentperfect
Militarymoderate militaristhighperfect
Moralitymoderate progressivemoderateperfect
Religionextreme secularexcellentperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
July 263843,579157,654,1780.03+0.0306250.00+0
July 26408,631,482159,194,0045.42+5.39346255.44+34
February 264110,011,120155,869,3396.42+1.00416256.56+7
February 264337,991,940158,684,93823.94+17.5214562523.20+104
February 264538,423,462153,243,17825.07+1.1316870024.00+23
February 264725,720,413155,314,03616.56-8.5111570016.43-53
June 264922,027,154156,037,14314.12-2.449970014.14-16
February 265120,050,203154,513,78312.98-1.149070012.86-9
February 265313,456,987158,085,0768.51-4.46627008.86-28
February 265518,646,590158,363,90211.77+3.268270011.71+20
February 265723,574,664156,003,99515.11+3.349870014.00+16

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Militant Revolutionary Armed Party (SI).

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383

BillCreatedVoting startedVoteBill StatusResult
Museum Decentralization Act of 3145May 3145May 3145defeated
Omnibus Decentralization BillJanuary 3144January 3144defeated
RP: 3144 Chancellorship Elections DebateNovember 3143March 3145passed
Freedom Enlargement of Democracy Amendment of October 3143October 3143January 3149defeated
Freedom Broadcasting Act of October 3143October 3143October 3143passed
SCI for a Rational CitizenryMay 3143September 3147passed
SCI Ban on ReligionMay 3143May 3143defeated
SCI Anti-Eminent Domain BillMay 3143May 3143defeated
Divorce by Province ActApril 3143April 3143defeated
Civil union universal recognition actApril 3143April 3143passed
Anti-insult to Ikradon billApril 3143April 3143defeated
SCI for a Direct DemocracyJanuary 3143May 3143defeated
SCI for a Pacifist IkradonJanuary 3143May 3143defeated
SCI Deregulation InitiativeJanuary 3143May 3143defeated
Communist Healthcare IINovember 3142November 3142defeated
Union Strengthening BillNovember 3142November 3142passed
Freedom Minimal Service Act of August 3142August 3142August 3142passed
Freedom Religious Charity Act of August 3142August 3142August 3142passed
Communist HealthcareJuly 3142July 3142defeated
Omnibus Decentralization Act of 3142June 3142June 3142defeated

Random fact: Real-life places should not be referenced in Particracy.

Random quote: “Human rights means doing whatever the fuck you want” - Benji Benandez, former Dranian politician

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51