Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5573
Next month in: 03:17:30
Server time: 16:42:29, November 24, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Ṡurby Qibuzzistit Qildarit[?]

This page contains information about the Ṡurby Qibuzzistit Qildarit.

This party is inactive.

Details

User[?]: the_original_trotka

Nation[?]: Gran Prinċipat ta’ Kildanja (Cildania)

Seats[?] in Kunsill tad-Deputati (Council of Deputies)[?]: 0

Color[?]:

 

Description[?]:

Luthori: Cildanian Communist Party
Canrillaise: Parti Communiste Cildanie
Zardic: Qildania Kommunismo Partio


Party Flag: http://images.wikia.com/particracy/images/0/06/Cildania_commie_flag_small.png


A kimiist party which believes in the concept of permanent revolution, and achievement of Social Equality and Feminism under communism. Found 3857, and not directly descended from the earlier Cildanian Communist Party, we are the single strongest political Party in Cildania today which espouses socialism and peaceful revolutionary ideals. We support the rights of all people, and seek respect and understanding. We advocate ceaselessly for the rights of workers

Youth Wing: Communist Youth Movement

Student Wing: Leftist Students for a Democratic Cildania

Military Wing: Cildanian People's Revolutionary Front

Hebil Wing: Communist Hebilean People's Front

Official Party Newsletter: The Dawn of the People


List of Communist Heads of Government:
Adonibaal bin Hiempsal Mekír (Adon 3877-3895)

________________________________________________
Executive Information

Central Body: Politburo of the Cildanian Communist Party

Chairman: Adonibaal bin Hiempsal Mekír
Vice Chairman: Bodmelqaart Emmen

Labor Relations Body: Laborboro of the Cildanian Communist Party

Chairman: Valerius Mecirius
________________________________________________
Party Ideology:

Permanent Revolution: Actions in support of socialism are part of a permanent communist revolution. We must support permanent revolution at home and abroad.

Solidarity: We stand with labour and our socialist brothers, at home and abroad, in the interests of revolution and improved standards of living, to close the income gap and eventually dissolve all classes and governments

Democratic Socialism: Democracy, for a communist, is a way of life. We seek to democratically elect our party leaders where possible, and work to revolt against undemocratic processes in our society

Dictatorship of the Proletariat: Hand over the means of production to be shared by the workers, and giving the workers democratic control over states. This will create a dictatorship in which the many, not the few, decide the fate of states




________________________________________________

EQUALITY is a word used acrostically to explain the policy of the Cildanian Communist Party

•E: stands for EQUALITY The Communist Party seeks equality of income, healthcare, education, and standard of living through Socialism. The Party also looks to advance equality of ethnicities, races, genders, sexual orientations, and religions. We are one world class of workers, and we should not allow trivial chains to keep us apart

•Q: Stands for QUALITY. The Communist Party aims for perfect government, infrastructure, healthcare, and foreign relations. By striving for perfection, we accomplish high things.

•U: Stands for UTILITARIANISM. We support solutions which are practical, easy to understand, and effective to implement.

•A: Stands for ANTIFASCISM. The Communist Party is opposed to fascism, imperialism, and globalism. Our world is under constant threat from evil influences and our party seeks to form a protective vanguard against fascism, imperialism, and globalism.

•L: Stands for LABOUR. The Communist Party is the party of the working proletariat in Cildania. We stand with Labour Unions and work together with them in order to bring about better working conditions and pay. We also seek to defend and promote the integrity and right to labour through our legislation

•I: Stands for INTERNATIONALISM. We support the furtherance of socialist revolution abroad through peaceful discourse with likeminded political and labour entities. We also are committed to foreign policy which promotes peace and non globalist interaction amongst peoples.

•T: Stands for TELEVISION. The Communist Party is devoted to the use of media to inform the proletariat and the people, in order to bring about their participation in a democratic society, leading to greater suffrage and the advance of socialism.

:Y: Stands for YOUTH. The Communist Party is devoted to educating and reaching out to the young people to further revolution and create in the young hearts which yearn for justice

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsmoderate permissivelimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketmoderate regulatorlimitedperfect
Militarymoderate militaristlimitedperfect
Moralityprogressive-leaninglimitedperfect
Religionmoderate secularlimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
May 385712,252,55312,252,553100.00+100.00550550100.00+550
August 38619,890,59553,303,17718.56-81.4410155018.36-449
September 386414,674,12648,446,81630.29+11.73237530.67-78
January 387011,101,29459,291,43218.72-11.578043518.39+57
June 38729,443,33658,616,74716.11-2.616843515.63-12
July 387411,474,49554,062,48221.22+5.119243521.15+24
July 387718,510,16554,160,05434.18+12.9514443533.10+52
August 387921,056,74151,911,12240.56+6.3917443540.00+30
August 388116,996,04753,610,35631.70-8.8613643531.26-38
August 388315,637,08650,432,35531.01-0.7013243530.34-4
November 38844,414,91532,326,93713.66-17.356343514.48-69
November 38864,779,63323,090,83120.70+7.049843522.53+35
November 388811,487,16211,487,162100.00+79.30435435100.00+337
November 389011,987,92111,987,921100.00+0.00435435100.00+0
November 389211,124,07411,124,074100.00+0.00435435100.00+0
November 389411,650,74411,650,744100.00+0.00435435100.00+0
November 389611,448,11611,448,116100.00+0.00435435100.00+0
November 389812,076,63412,076,634100.00+0.00435435100.00+0
November 390011,796,04311,796,043100.00+0.00435435100.00+0
November 390211,616,54511,616,545100.00+0.00435435100.00+0
November 390412,244,70612,244,706100.00+0.00435435100.00+0

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Ṡurby Qibuzzistit Qildarit.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449

BillCreatedVoting startedVoteBill StatusResult
The Prisoner of War BillOctober 3869January 3870abstaindefeatedabstained
Foreign Relations DecreeOctober 3869January 3870abstaindefeatedabstained
The Green DecreeOctober 3869January 3870abstaindefeatedabstained
RP EVENT: The Crackdown of Religious ElementsSeptember 3869September 3875abstaindefeatedabstained
OOC: Update of the Cultural Protocol LanguageSeptember 3869September 3875abstaindefeatedabstained
The Religious Cleansing DecreeSeptember 3869January 3870abstaindefeatedabstained
Civilian Weapons Act (3869)August 3869January 3870abstainpassedabstained
Land Mines Act (3869)August 3869January 3870abstaindefeatedabstained
Campaign Financing Act (3869)August 3869January 3870abstainpassedabstained
Law Enforcement Activities Act (3869)August 3869January 3870yesdefeatedlost
Adoption Act (3869)August 3869January 3870abstaindefeatedabstained
Eminent Domain Act (3869)August 3869January 3870abstainpassedabstained
Workers Soviets Act (3869)August 3869January 3870yesdefeatedlost
Paramilitaries Act (3869)August 3869January 3870abstainpassedabstained
The Cildanian Imperial ConstitutionMay 3869September 3875abstaindefeatedabstained
The Imperial Decree; New name of the Imperial ProvincesMay 3869May 3869nopassedlost
The Most Serene Cildanian Imperial Constitution;September 3868May 3869nodefeatedwon
Budget proposal of September 3868September 3868September 3868abstainpassedabstained
Sibilla Care BillSeptember 3868September 3868abstainpassedabstained
Reproductive Freedom ActJune 3868June 3868yesdefeatedlost

Random fact: If your "Bills under debate" section is cluttered up with old bills created by inactive parties, report them for deletion on the Bill Clearouts Requests thread: http://forum.particracy.net/viewtopic.php?f=11&t=4363

Random quote: "It depends upon what the meaning of the word 'is' is." - Bill Clinton

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51