Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5573
Next month in: 03:16:45
Server time: 16:43:14, November 24, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Pars Militum Petulantia[?]

This page contains information about the Pars Militum Petulantia.

This party is inactive.

Details

User[?]: RubenPT

Nation[?]: Res Publica Seluciae (Selucia)

Seats[?] in Senātus Populī[?]: 0

Color[?]:

 

Description[?]:

Founded by Marcus Antonius Marinus Cato in 4302, renamed to the Pars Militum Petulantia in 4318 under the leadership of Claudius Tatius Cnaes Gaius., the current Imperator of Selucia.


Ideologies: Nationalism, Militarism, Conservatism, Centralization

Motto: Non sibi sed patriae (Not for self, but for country)


DISCLAIMER: The views and opinions expressed here, do not necessarily represent my own political beliefs. Any comments or statements made that may or may not cause offence are written for the sake of the game, and not directed at any users or groups in real life.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightsmoderate restrictivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketmoderate regulatormoderateperfect
Militaryconvinced militaristhighperfect
Moralitymoderate conservativemoderateperfect
Religionreligious-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
November 430244,85468,124,9650.07+0.0705010.00+0
September 43035,018,36564,558,4417.77+7.71385017.58+38
June 430514,410,26662,534,81923.04+15.2717475023.20+136
May 430812,238,77058,347,01820.98-2.0715275020.27-22
November 431013,531,90359,710,55022.66+1.6916875022.40+16
November 431413,625,78058,417,91623.32+0.6617375023.07+5
November 43188,949,31062,329,43314.36-8.9710675014.13-67
November 432014,752,54450,517,52629.20+14.8420975027.87+103
October 432224,768,11851,174,10948.40+19.2035375047.07+144
October 43269,258,82360,279,85115.36-33.0411575015.33-238
October 433028,425,31162,639,44445.38+30.0233975045.20+224
October 433426,722,82763,583,71642.03-3.3531475041.87-25
October 433817,436,65757,268,07430.45-11.5822575030.00-89
April 434214,703,20452,339,22028.09-2.3621075028.00-15
April 434615,601,27551,727,92730.16+2.0722575030.00+15

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Pars Militum Petulantia.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473

BillCreatedVoting startedVoteBill StatusResult
Religious Freedom BillNovember 3826April 3827passed
Cabinet Proposal of November 3826November 3826November 3826defeated
Solving the Cabinet CrisisJune 3826June 3826defeated
Cabinet Proposal of February 3826February 3826February 3826defeated
Eminent Domain ReformAugust 3825April 3826defeated
Strike ActApril 3825April 3825defeated
Special Situation for 3825 (until election)January 3825January 3825defeated
Election BillJanuary 3825January 3825passed
Free the EconomyJuly 3824July 3824defeated
Special Situation for 3824November 3823November 3823defeated
Disaster Relief & AidJune 3823June 3823defeated
Waste Management ReformMay 3823May 3823defeated
Women's RightsApril 3823April 3823defeated
ReligiousOctober 3822May 3823passed
Spcial Situation for 3823October 3822October 3822defeated
A Tolerant SocietyJuly 3821July 3821defeated
New Age PunishmentJuly 3821July 3821defeated
Decentralization of the System of CourtsJuly 3821July 3821defeated
Banking ReformJune 3821June 3821defeated
Welfare DevolutionJune 3821June 3821defeated

Random fact: Make sure to check out Particracy's wiki. http://particracy.wikia.com/wiki/Main_Page

Random quote: "He who is unable to live in society, or who has no need because he is sufficient for himself, must be either a beast or a god." - Aristotle

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51