Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: March 5587
Next month in: 02:54:33
Server time: 17:05:26, December 21, 2024 CET
Currently online (2): AR Drax | GeorgeWKush | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Alt-Right Alliance[?]

This page contains information about the Alt-Right Alliance.

This party is inactive.

Details

User[?]: Pepe the frog

Nation[?]: Federale Republiek van Seridjan (Saridan)

Seats[?] in Volksraad (People's Council)[?]: 0

Color[?]:

 

Description[?]:

🔺ALT-RIGHT ALLIANCE🔺
———————————————————————————————–———————————————————————————————
The Alt-Right Alliance is a Saridanian far right political party founded in April 4132 by billionaire businessman Dewald Liebenberg. Liebenberg was the former CEO and founder of Blexon International. The Party was set up in order to protect whites in Saridan, and to create a white ethnostate within the Republic of Saridan. The ARA is also staunchly against globalism, and thus endorses and promotes economic protectionism.

🏴FLAG: http://www.volkstaat.net/images/storia_boera/bandiere/awb.gif

📆ESTABLISHED: April, 4132

🏨HEADQUARTERS: Koeistad, TS

👤PARTY CHAIRMAN: Hendrik De La Rey

↔️POSITION: Far-Right

💡IDEOLOGY: Fascism, White Nationalism, Economic Protectionism

📝MOTTO: “Our Nation. Our People. First!"

📰NEWSPAPER: The New Dawn Press

💺SEATS: 167/500 (33.40%)

👥STAATSPRESIDENTS:
Dewald Liebenberg...............4135 – 4148 https://goo.gl/images/2zWdHc
Ted Kleinveldt.......................4152 – 4157 https://goo.gl/images/AvstnE
J. F. Strydom........................4230 – 4246 https://goo.gl/images/rQw6JD
F. D. Hartzenburg.................4246 – 4250
Richard de Koch...................4256 – 4267
Rex W. Randburg.................4267 – 4277
F. W. De Boer.......................4277 – 4285
Herbert Holtzer.....................4285 – 4289
Pieter Van Vuuren................4372 – 4382

👥VISE STAATSPRESIDENTS:
Robert F. Kriel......................4135 – 4148
Rudy Nel..............................4152 – 4157
Paul de Klerk.......................4230 – 4246
Lionel J. Mostert..................4246 – 4250
Gerald Combrinck...............4256 – 4267
Bob Weise...........................4267 – 4277
Herbert Holtzer....................4277 – 4285
Robert E. Britz.....................4285 – 4289
Conrad Terblanche..............4372 – 4381

🌍ON IMMIGRATION:
The Alt-Right Alliance is strictly against non white immigration and refugees, the party has strict policy to protect Saridan's borders. The ARA also wants to keep Saridan racially and culturally homogenous, and is thus opposed to non white immigrants entering the country.

"We must secure the existence of our people, and a future for white children." — Dewald Liebenberg (Party Founder & Former Staatspresident 4135-4148).

•Stronger Borders and Border control
•Exteme vetting
•No intake of refugees
•Actively search for, and deport all illegal aliens
•Reduce legal immigration intake
•Ban non white immigration

📜ON CIVIL LIBERTIES:
The ARA is strictly conservative and believes in protecting traditionalism and the family, which is what has made Saridan great. The Alt-Right Alliance has also railed against Cultural Marxism, which threatens the traditional structure of family and faith, and has crippled other nations morally. The party as a result is strictly against gay marriage and interracial relationships.

"We must protect our traditional heritage, we must protect the family, and we must destroy the poison of Cultural Marxism and its evil perverted anti white agenda.” — James Francois Strydom (Former Staatspresident 4230-4246).

•Support traditional marriage and families
•Support freedom of speech
•Protect and preserve Duntrekker culture
•Ban race mixing
•Ban homosexual marriage & LGBT propaganda
•Re-institute segregation

📈ON THE ECONOMY:
The ARA believes in lowering taxes, especially for small businesses and those on low incomes.The ARA is considered economically centrist, believing in the ideas of capitalism, while allowing a safety net, and protectionist policies to help the white working class. The Alt-Right Alliance has also vowed to further Saridan industrially and make it into the manufacturing capital of the world.

"In a globalised economy it is the working class who get left behind. We will not allow this to happen, our economic plan will put Saridan first and globalism last." — Rudy Nel (Former Finance Minister 4135-4148 & Former Vise Staatspresident 4152-4157).

•Industrialise the economy
•Prevent offshoring
•Crackdown on foreign workers
•Lower taxes for the poor
•Promote privatisation and increased competition
•Cut small business regulations by 50%
•Enforce protectionist trade tariffs
•Break up monopolies

🌐ON FOREIGN POLICY:
The ARA believes in isolationism, this means we are opposed to giving other nations foreign aid. Saridan's wealth should be spent on Saridan.

"Globalism by it's very nature is evil, and those who support it, know they are committing a great treason against their people. That is why we must stand strong and shun the ugly face of globalism." — Herbert van Rensburg (Former Foreign Affairs Minister 4135-4148 & Former Party Chairman 4148-4150).

•Tougher diplomacy
•Abolish foreign aid
•Cut ties with Istalia
•Enact blood right only citizenship

🎓ON EDUCATION:
The ARA aims to dismantle the government enforced national curriculum and return that right back to the schools, thus increasing competition among schools, and improving the education system. The ARA also wants to privatise education and allow for charter schools. The Party also aims to introduce government means tested loans for college students to be paid back after the students earn over a certain income threshold.

•Promote charter schools
•Affordable college loans to minimise student debt
•Bring back school choice curriculum
•Privatise educational institutions

☢ON THE MILITARY
The Alt Right Alliance believes the best way of maintaining peace, is through military strength. However, the ARA believes military force should only be used if the situation calls for it, or as a last measure if all other options have failed.

"Peace can only be achieved through strength. Our national sovereignty relies on our enemies being afraid to act against a superior military force." — Gen. F. W. De Boer (Former Minister of Defence 4267-4277 & Former Staatspresident 4277-4285).

•Upgrade military arsenal
•Expand nuclear weapons program
•Legalise torture against enemies
•Build Saridan into military superpower
•Increase military spending
•Unlift ban on chemical and biological weapons

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristmoderateperfect
Civil Rightsmoderate restrictivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate isolationistmoderateperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketmoderate laissez-fairemoderateperfect
Militaryconvinced militaristclose to noneperfect
Moralityconvinced conservativehighperfect
Religionconvinced religiouslimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
April 41338,510,62361,026,02613.95+13.952317513.14+23
October 413517,435,92858,029,61330.05+16.105417530.86+31
October 413918,317,24061,361,75529.85-0.205317530.29-1
October 414325,296,01061,014,78441.46+11.617517542.86+22
October 414717,906,97161,368,21329.18-12.285017528.57-25
October 414818,090,09858,240,22631.06+1.885317530.29+3
October 415212,256,39657,953,07821.15-9.913717521.14-16
October 415316,448,89756,911,35428.90+7.755017528.57+13
October 415710,062,72756,841,80317.70-11.203217518.29-18
October 416113,566,82964,179,63121.14+3.443617520.57+4
October 416511,627,44460,595,31419.19-1.953317518.86-3
January 416611,808,38961,495,30319.20+0.013317518.86+0
January 41708,702,88161,092,38114.25-4.963927514.18+6
January 41746,537,35361,922,00610.56-3.692827510.18-11
July 42136,818,22362,581,36110.89+0.342827510.18+0
August 421410,150,22260,959,37016.65+5.764527516.36+17
August 42189,333,92458,732,21115.89-0.764427516.00-1
August 42226,793,92762,676,16610.84-5.052927510.55-15
April 42246,928,52359,326,57111.68+0.843127511.27+2
December 42269,845,37065,395,97015.06+3.384127514.91+10
December 423020,201,08461,271,00232.97+17.9211935533.52+78
December 423419,706,09460,387,42832.63-0.3411635532.68-3
December 423815,204,26259,951,43225.36-7.279035525.35-26
December 424219,871,98358,741,14233.83+8.4711935533.52+29
December 424616,910,52156,612,28229.87-3.9610435529.30-15
April 425014,489,52255,828,56625.95-3.929035525.35-14
January 425213,726,51558,732,92823.37-2.588235523.10-8
January 425617,885,84560,367,75029.63+6.2610535529.58+23
January 426019,428,72550,091,46038.79+9.1613335537.46+28
January 42645,602,99229,897,71718.74-20.056735518.87-66
January 426725,094,26243,143,85058.16+39.4220535557.75+138
January 427121,391,75043,595,60949.07-9.1017235548.45-33
November 427111,829,18811,829,188100.00+50.93355355100.00+183
November 427557,527,91257,558,66299.95-0.05355355100.00+0
October 427756,992,87957,021,57999.95+0.00355355100.00+0
October 428112,010,78712,050,82999.67-0.28355355100.00+0
October 428511,949,44911,949,449100.00+0.33355355100.00+0
October 428915,854,97636,408,96143.55-56.4515435543.38-201
October 429315,544,10349,953,96631.12-12.4311435532.11-40
April 433611,192,00860,975,25518.35-12.766635518.59-48
November 437229,049,83744,052,48265.94+47.5930350060.60+237
November 437662,548,88462,669,12299.81+33.86500500100.00+197
November 438018,591,39463,098,06829.46-70.3414450028.80-356
May 43828,575,05763,526,91413.50-15.976650013.20-78
May 438613,603,14159,566,90522.84+9.3411650023.20+50
July 438915,211,99855,084,07427.62+4.7814650029.20+30
July 439316,135,65248,663,84033.16+5.5416650033.20+20
July 439718,719,66756,057,23333.39+0.2416750033.40+1
July 440116,471,72647,685,72034.54+1.1517150034.20+4

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Alt-Right Alliance.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394

BillCreatedVoting startedVoteBill StatusResult
Income tax proposal of February 3378February 3378February 3378passed
Reform Bill of 3378February 3378February 3378passed
Cabinet Proposal of July 3376July 3376July 3376passed
Energy and TOC Administration: State over PrivateMay 3376October 3377defeated
Red BillMay 3373May 3373defeated
Cabinet Proposal of December 3372December 3372May 3373defeated
Motion for the Renaming of the ParliamentNovember 3372May 3376passed
Revision Act No.4January 3371January 3371defeated
Red ProposalMay 3370June 3370defeated
Reform Bill of 3369June 3369June 3369passed
Reform Bill 3365November 3365November 3365passed
Revision Act No.3April 3365April 3368passed
Revision Act No.2December 3363July 3364passed
Red proposalNovember 3363September 3364defeated
Budget proposal of November 3363November 3363November 3363passed
Eminent Domain ReformJanuary 3362January 3362passed
ReformsNovember 3361May 3362passed
Revision Act No.1November 3361November 3361passed
Red ProposalNovember 3361November 3361defeated
Ratification of the Openning An Embassy in Jakania PolicyMay 3361May 3361defeated

Random fact: Real life-life nationalities, cultures or ethnicities should not be referenced in Particracy (eg. "German").

Random quote: "When we're unemployed, we're called lazy; when the whites are unemployed it's called a depression." - Jesse Jackson

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51