Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5573
Next month in: 03:11:13
Server time: 16:48:46, November 24, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Labour Party[?]

This page contains information about the Labour Party.

This party is inactive.

Details

User[?]: gavingrotegut

Nation[?]: Voronan Federation (Vorona)

Seats[?] in Council[?]: 0

Color[?]:

 

Description[?]:

The Labour Party is a left-wing political party. We support democratic socialism and direct democracy. Our party supprts the interests of people, not corporations.

Party Status:
In extra parliamentary opposition: 4320-4322, 4330-4330
In coalition: 4322-24
Inactive: 4324-4330, 4336-4338
Leading coalition: 4330-4338

Leadership:
Mark Synthins: 4320-4339
Cassandra Day: 4339-?

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate federalistexcellentperfect
Civil Rightsrestrictive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalisthighperfect
Government Responsibilitiesmoderate big governmenthighperfect
Marketmoderate regulatorexcellentperfect
Militarymoderate militaristlimitedperfect
Moralityconvinced progressivehighperfect
Religionmoderate secularlimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
November 43224,783,61224,766,66419.31+19.319850019.60+98
May 43309,562,14925,809,87937.05+17.7318550037.00+87
May 43335,386,23126,695,39520.18-16.8710250020.40-83
May 43366,665,11027,019,18424.67+4.4912550025.00+23
April 4339745,72424,974,2692.99-21.68217502.80-104
April 43422,145,36925,350,0368.46+5.48647508.53+43
July 43441,291,95324,703,8285.23-3.23397505.20-25

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Labour Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332

BillCreatedVoting startedVoteBill StatusResult
Social Reform and Development ActMay 5019May 5019defeated
Centralization ActMay 5019May 5019defeated
Economic Reforms ActNovember 5016November 5016defeated
Labour and Industry Reform ActJune 5014June 5014passed
Cabinet Proposal of June 5014June 5014June 5014passed
Income tax proposal of September 5013September 5013September 5013defeated
Call for early elections, September 5013September 5013September 5013defeated
Vorona Farmers Relief ActSeptember 5010September 5010passed
Software Innovation InitiativeSeptember 5010September 5010passed
Telecom Expansion ActSeptember 5010September 5010passed
Space Exploration Freedom ActSeptember 5010September 5010passed
Vorona Religious Freedom ActSeptember 5009September 5010passed
Peaceful Assembly ActMarch 5009September 5009defeated
Eminent Domain ActMarch 5009September 5009defeated
Recycling and Animal Welfare ActMarch 5009September 5009defeated
Industry and Labour ActMarch 5009September 5009defeated
Freedom of Information ActMarch 5009March 5009passed
New Government Reform ActFebruary 5009February 5009passed
Vorona Military Science Advancement ActOctober 5008October 5008passed
Government Reorganization ActMarch 5008October 5008passed

Random fact: Players who deliberately attempt to present a misleading picture of the nation's current RP laws will be subject to sanction.

Random quote: "I think that gay marriage is something that should be between a man and a woman." - Arnold Schwarzenegger

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51