Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: May 5488
Next month in: 03:15:48
Server time: 08:44:11, May 24, 2024 CET
Currently online (1): Morman Horthy | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Chidan Party[?]

This page contains information about the Chidan Party.

This party is inactive.

Details

User[?]: Chidan

Nation[?]: Harmadik Ndráloni Direktoriális Köztársaság (Endralon)

Seats[?] in Legislative Senate[?]: 0

Color[?]:

 

Description[?]:

Dedicated to the equal treatment of all its citizens, The Chidan Party (named after its founder, Maria Chi, since retired) aims to maintain a level of serenity and contentment among its people. The Chidan Party is particularly concerned with issues regarding the fair and equal treatment of all minority groups within society and firmly believes in the formation of a strong economic system that can benefit society as a whole.

-------------------------------------------------------------------------

Having split quite some time ago, The Chidan Party has returned to, once again, bring equality to this great nation, through libertarian politics.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsmoderate permissivelimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistclose to noneperfect
Government Responsibilitiesunknownclose to noneperfect
Marketunknownclose to noneperfect
Militarypacifist-leaninglimitedperfect
Moralitymoderate progressivelimitedperfect
Religionconvinced secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
January 253823,796,380108,369,22021.96+21.9616575022.00+165
July 254021,470,486108,941,78819.71-2.2514775019.60-18
March 254323,899,330114,344,68220.90+1.1915775020.93+10
April 254324,371,200115,398,52621.12+0.2216075021.33+3
October 254523,908,949114,225,31520.93-0.1915775020.93-3
April 254813,949,305114,280,15112.21-8.739075012.00-67
October 25507,315,263114,928,1266.37-5.84467506.13-44
April 25537,093,156117,323,4376.05-0.32457506.00-1
October 255511,869,539120,840,1609.82+3.78737509.73+28
April 255811,179,586120,735,1989.26-0.56707509.33-3
May 255929,765,634117,158,91825.41+16.1519375025.73+123
November 256128,335,669110,752,89225.58+0.1819175025.47-2
May 256424,870,768118,616,64520.97-4.6216075021.33-31
November 256611,447,067120,510,0969.50-11.47717509.47-89
May 25697,029,979121,011,8075.81-3.69427505.60-29
November 257111,651,416124,255,2069.38+3.57707509.33+28
May 25748,368,634121,291,0366.90-2.48507506.67-20
November 257615,315,736119,867,33312.78+5.889675012.80+46
May 25799,045,658123,847,5417.30-5.47527506.93-44
November 25817,649,166122,843,8166.23-1.08457506.00-7
May 258410,883,715129,604,4668.40+2.17627508.27+17
November 258611,950,997130,494,6059.16+0.76677508.93+5
May 258913,411,983131,471,99310.20+1.047675010.13+9
November 259112,922,647125,846,57310.27+0.077575010.00-1
May 259413,940,253136,537,99810.21-0.067775010.27+2
November 259615,711,036134,583,26111.67+1.468775011.60+10
May 259916,754,236137,234,45512.21+0.539075012.00+3
November 260116,718,143136,660,85812.23+0.029175012.13+1
May 260427,126,276139,632,74519.43+7.1914575019.33+54
November 260627,710,222141,733,89519.55+0.1214775019.60+2
November 261112,266,373136,442,8058.99-10.56667508.80-81
May 261423,563,243139,523,63216.89+7.9012575016.67+59
November 261633,051,305128,345,76725.75+8.8619475025.87+69
May 261932,080,831129,586,84224.76-1.0019175025.47-3
November 262130,186,694132,620,83622.76-1.9917275022.93-19
May 262443,727,848128,091,29134.14+11.3826575035.33+93
November 262671,993,255130,870,03755.01+20.8741875055.73+153
May 262954,158,547144,093,96937.59-17.4328475037.87-134
November 263145,277,855150,135,57730.16-7.4322875030.40-56
February 263245,403,801150,895,78630.09-0.0722675030.13-2
August 263430,532,831151,532,86420.15-9.9415275020.27-74
February 263723,475,474146,209,23616.06-4.0911975015.87-33
August 263921,499,619149,810,58414.35-1.7010875014.40-11
February 264221,030,371147,995,30914.21-0.1410775014.27-1
August 264415,298,523148,555,34510.30-3.917575010.00-32
February 264718,949,501158,252,62311.97+1.688975011.87+14
August 264918,989,201154,138,01512.32+0.359375012.40+4
February 265220,085,054151,721,40713.24+0.929875013.07+5
August 265417,841,239160,000,37911.15-2.098275010.93-16
February 265719,805,442151,964,37313.03+1.889875013.07+16
August 265921,769,006162,089,41513.43+0.4010075013.33+2
February 266220,694,346148,991,29813.89+0.4610475013.87+4
August 266414,216,957153,377,9489.27-4.62687509.07-36
February 266719,970,361152,224,79313.12+3.859875013.07+30
August 266920,909,262154,343,16313.55+0.4310275013.60+4
February 267222,287,327164,363,31113.56+0.0110175013.47-1
August 267422,079,215167,262,59013.20-0.369775012.93-4
March 270246,661,977186,019,03325.08+11.8819075025.33+93
September 270425,337,421183,286,93813.82-11.2610275013.60-88
March 270728,204,598183,792,51215.35+1.5211675015.47+14
May 270837,852,853190,196,14719.90+4.5614975019.87+33
November 271024,678,178192,781,77212.80-7.109575012.67-54
May 271319,709,835194,408,81810.14-2.667675010.13-19
November 27159,683,165192,268,2325.04-5.10377504.93-39
May 27189,582,807194,594,7984.92-0.11367504.80-1
November 272018,805,116195,034,9529.64+4.72737509.73+37

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Chidan Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505

BillCreatedVoting startedVoteBill StatusResult
The time at which sexually explicit content may be shown on broadcast televisionAugust 2710August 2713abstainpassedabstained
Education actAugust 2710August 2713abstainpassedabstained
The Government's policy towards the use of land mines by the armyAugust 2710September 2712abstainpassedabstained
Government-issued identity card policyAugust 2710September 2712abstainpassedabstained
Licensing of Food SalesMarch 2710March 2710nodefeatedwon
The government's policy concerning child laborMarch 2710March 2710nodefeatedwon
Government policy towards alcoholic beveragesMarch 2710March 2710yesdefeatedlost
The government's policy concerning the use of chemical and biological weaponry in warfareMarch 2710March 2710yesdefeatedlost
Eminent Domain compensationMarch 2710March 2710yespassedwon
The government's policy regarding regulation of media content.March 2710March 2710yespassedwon
Government-issued identity card policy.March 2710March 2710yespassedwon
The use of animals in medical research.March 2710March 2710nodefeatedwon
The government's policy towards fireworksMarch 2710March 2710nopassedlost
Aggricultural Federalization ActMarch 2710March 2710nopassedlost
Ratification of the Northern Area Treaty Organisation (NATO)May 2709June 2709nodefeatedwon
Foreign Policy Change.May 2709May 2709nodefeatedwon
Smaller governmentMay 2709May 2709nodefeatedwon
Term LimitsMay 2709May 2709nodefeatedwon
slight change in policyMay 2709May 2709yespassedwon
Needed ChangeMay 2709May 2709nopassedlost

Random fact: Never use the same password as a friend. If two or more active accounts use the same password, they will be inactivated.

Random quote: "The substance of the eminent Socialist gentlemen's speech is that making a profit is a sin. It is my belief that the real sin is taking a loss!" - Winston Churchill

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51