Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: June 5500
Next month in: 00:30:13
Server time: 15:29:46, June 17, 2024 CET
Currently online (3): hexaus21 | Luzzina | Vesica5 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Saradani Beat[?]

This page contains information about the Saradani Beat.

This party is inactive.

Details

User[?]: Karlo Nietz

Nation[?]: Federale Republiek van Seridjan (Saridan)

Seats[?] in Volksraad (People's Council)[?]: 0

Color[?]:

 

Description[?]:

The Saridani Beat began as a small group of politically active and revolutionary-minded artists and writers, who after becoming notorious in Saridani popular culture, formed as a political party in 2688. They have since remained dedicated to their left-libertarian ideologies. They are headed by Karlo Nietz, former revolutionary commandant.



"Freedom is a funny word. It is a word tossed around and habitually raped by our right-wing counterparts to portray and justify many of their moves. However, Saridan shall not know true freedom until the shackles bound by the burden of tradition are well and truly shattered,"
Karlo Nietz

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristmoderateperfect
Civil Rightsrestrictive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiesmoderate big governmentmoderateperfect
Marketextreme regulatormoderateperfect
Militarypacifist-leaninglimitedperfect
Moralitymoderate progressivemoderateperfect
Religionmoderate secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
January 2688112,903153,140,3220.07+0.0707500.00+0
January 269219,199,891167,667,70611.45+11.387975010.53+79
January 269632,480,707163,395,76419.88+8.4315075020.00+71
January 270033,389,470169,671,65319.68-0.2015175020.13+1
January 270438,508,760193,230,15019.93+0.2514875019.73-3
October 27067,678,111113,581,1296.76-13.17547507.20-94
October 271027,252,909152,610,05017.86+11.1013575018.00+81
October 27148,297,506189,560,7834.38-13.48337504.40-102
February 271923,409,620194,627,61112.03+7.659375012.40+60
June 272338,535,433206,778,24418.64+6.6114175018.80+48
April 272720,659,004182,179,08011.34-7.308875011.73-53
October 273034,607,280156,709,64022.08+10.7416875022.40+80
February 273538,060,990217,593,48117.49-4.5913175017.47-37
June 273937,195,772217,351,05417.11-0.3812875017.07-3
October 274324,584,061215,158,72311.43-5.698575011.33-43

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Saradani Beat.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393

BillCreatedVoting startedVoteBill StatusResult
Spanking BillJanuary 2228August 2228passed
Changing the name of the nationJanuary 2228January 2228passed
Eminent Domain PolicyDecember 2227December 2227defeated
Private Mail Carrier Regulation ActDecember 2227December 2227passed
Public Higher Education ActDecember 2227December 2227passed
Regulation ReductionNovember 2227November 2227defeated
International AidNovember 2227November 2227passed
Privitizing Television and RadioNovember 2227November 2227defeated
LSA Religion BillNovember 2227November 2227defeated
Budget proposal of October 2227October 2227February 2228defeated
Income tax proposal of October 2227October 2227February 2228defeated
TaxesOctober 2227October 2227passed
Abortion BillAugust 2227January 2228passed
Civil Service Reform BillAugust 2227January 2228passed
motto proposalJuly 2227January 2228defeated
Affirmative Action ActJuly 2227July 2227defeated
New Legislature NameJune 2227June 2227defeated
StuffJune 2227June 2227defeated
No Work for 15-year-olds ActMay 2227May 2227defeated
Civil RightsApril 2227May 2227passed

Random fact: Real-life places should not be referenced in Particracy.

Random quote: "Democracy means simply the bludgeoning of the people by the people for the people." - Oscar Wilde

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51