Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: February 5501
Next month in: 03:47:34
Server time: 20:12:25, June 18, 2024 CET
Currently online (3): Interstellar. | Maarten_saridan | Tayes_Kaf | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Christian Democratic Union of Dolgaria[?]

This page contains information about the Christian Democratic Union of Dolgaria.

This party is inactive.

Details

User[?]: Serapindal

Nation[?]: Dolgavas Impērija / Dolgavan Empire (Dolgava)

Seats[?] in Dolgavas impērijas parlaments (Imperial Dolgavan Parliament)[?]: 0

Color[?]:

 

Description[?]:

The Christian Democratic Union:
* Supports an emphasis on human rights and individual initiative.
* Has a rejection of laicity, and an emphasis on the fact that the individual is part of a community and has duties towards it.
* Possesses Conservative moral values (i.e. on issues such as education, divorce, abortion etc.), a view of the evolutionary development of society, an emphasis on law and order, and a rejection of communism.
* Is also open to change (e.g. in the structure of society) and not necessarily supportive of the social status quo.
* Has a strong emphasis on social solidarity (i.e. public transportation, prioritizing alleviation of poverty, high taxes on the wealthy, etc.) and a willingness to restrain market forces.
* Supports capitalism and a market economy and does not advocate class struggle.

We believe that in "National Action" which rejects a fundamental adherence to left- or right-wing politics or policies, instead requiring the adoption of such policies as correspond to the problems faced by the nation at any given moment. Thus both right and left wing policies may be considered equally carefully in formulation of national policy.

Our theory of National Action politics, rejecting a fundamental adherence to right or left, is held within a strongly religious context, and clearly falls under the definition of Christian Democracy.

The party is non-denominational Christian-based, applying the principles of Christian Democracy and serving to "unite Catholics and Protestants, Conservatives and Liberals, proponents of Christian social ideals, and men and women from various regions, social classes, and democratic traditions." The CDU believes that mankind has a responsibility to God in upholding the Christian ideals and caring for the environment. Parts of these beliefs include supporting the freedom and dignity of all persons including equal rights among women, men, and the disabled. The CDU supports the idea of a social market economy.

We host various strands of thought such as the Christian-social thinking as popular among the Catholic working class, emphasizing faith and social justice according to a Roman Catholic view of man; moderately Nationalist-conservative thinking as popular in most rural areas and small towns of Dolgaria, emphasizing a defence of traditional Dolgarian culture and values; and free-market economic liberalism as popular among business interests and the middle/upper classes, emphasizing economic freedom and self-determination.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsrestrictive-leaningexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketregulator-leaninghighperfect
Militaryconvinced militaristclose to noneperfect
Moralityconservative-leaninglimitedperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
December 218515,76838,350,1670.04+0.0407500.00+0
September 24011,001,37568,711,9871.46+1.4295551.62+9
March 24043,782,92771,552,5235.29+3.83285555.05+19
September 24063,307,32872,612,2354.55-0.73245554.32-4
March 24093,243,50072,861,5214.45-0.10235554.14-1
August 24124,116,70072,516,7565.68+1.23295555.23+6

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Christian Democratic Union of Dolgaria.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394

BillCreatedVoting startedVoteBill StatusResult
Criminal Justice Act 2113February 2113February 2113passed
Eminent Domain Compensation Act 2113February 2113February 2113passed
Off with the King's Head ActDecember 2112December 2112defeated
Educational Discipline Compromise of 2112November 2112November 2112passed
Free Trade Act 2112October 2112October 2112defeated
Nationalization BillSeptember 2112September 2112defeated
Responsible Alcohol Act 2112August 2112August 2112passed
Legislative Reform Act 2112August 2112August 2112defeated
Rational Legislative Action Bill 2112August 2112August 2112defeated
Tax Reform 2112August 2112August 2112passed
Medical drugs social Act 2112August 2112August 2112passed
Legalization of Drugs ActAugust 2112August 2112passed
Toward an intellectualist societyAugust 2112August 2112passed
Cabinet Reform Act 2111August 2112August 2112defeated
Yet another monarchy abolition actJuly 2112July 2112defeated
Blow My Quota Bill of 2112June 2112June 2112defeated
Secularizing our SchoolsMay 2112May 2112passed
Education ActMay 2112May 2112passed
Domestic Animals ActApril 2112April 2112passed
Discipline in Educational institutions Act 2112April 2112April 2112passed

Random fact: Real life-life nationalities, cultures or ethnicities should not be referenced in Particracy (eg. "German").

Random quote: "Democracy is more dangerous than fire. Fire can't vote itself immune to water." - Michael Z. Williamson

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51