Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: November 5499
Next month in: 03:08:19
Server time: 08:51:40, June 16, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Conservative Party of Lourenne[?]

This page contains information about the Conservative Party of Lourenne.

This party is inactive.

Details

User[?]: Travis_White

Nation[?]: Royaume Uni de Lourenne (Lourenne)

Seats[?] in Assembleé Royale (Royal Assembly)[?]: 0

Color[?]:

 

Description[?]:

We are The Conservative Party of Lourenne, We are for freedom, liberty, and justice for all!

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristlimitedperfect
Civil Rightsmoderate permissivelimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsunknownclose to noneperfect
Government Responsibilitiesmoderate small governmenthighperfect
Marketconvinced laissez-fairemoderateperfect
Militaryconvinced militaristclose to noneperfect
Moralitymoderate progressiveclose to noneperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
July 345855,11658,021,2610.09+0.0902150.00+0
August 345834,08758,459,8340.06-0.0402150.00+0
March 346042,61260,605,8150.07+0.0102150.00+0
November 34625,109,48252,183,1989.79+9.722721512.56+27
December 34666,166,49164,438,9159.57-0.22212159.77-6
December 34705,370,19855,066,4869.75+0.18202159.30-1
December 347411,499,86353,530,61421.48+11.735523523.40+35
December 34788,610,46450,411,49717.08-4.403923516.60-16
October 34815,312,55341,305,14812.86-4.22212358.94-18

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Conservative Party of Lourenne.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321

BillCreatedVoting startedVoteBill StatusResult
Foreign Relations BillFebruary 5287February 5287passed
Social Welfare (Government) Centralisation BillFebruary 5287February 5287passed
Cabinet Proposal of December 5286December 5286March 5287passed
Environmental Standards ActNovember 5285February 5286passed
Local Government Powers (Sports Clubs) BillSeptember 5285September 5285defeated
National Sport ActMarch 5285March 5285passed
Coalition Government CabinetOctober 5283October 5283passed
Call for early elections, August 5283August 5283August 5283passed
Pharmaceutical Advertising Regulation ActMay 5283October 5283passed
Cabinet Proposal of December 5282December 5282December 5282defeated
Foreign Mission Banning ActMarch 5282March 5282passed
Call for early elections, December 5281December 5281December 5281passed
Infrastructure Modernisation BillJuly 5281July 5281passed
Cabinet Proposal of February 5281February 5281July 5281defeated
Cabinet Proposal of February 5281February 5281February 5281defeated
Eminent Domain Compensation ActMarch 5280January 5281passed
Call for early elections, February 5280February 5280February 5280passed
The Care ActSeptember 5279January 5281passed
Police Nationale de Lourenne Enhancement ActSeptember 5279December 5279passed
Cabinet Proposal of February 5279February 5279February 5279passed

Random fact: Any RP law granting extraordinary "emergency powers" or dictator-like powers to a government must be passed by at least a 2/3rds majority, but (like all RP laws) may always be overturned by a simple majority vote of the legislature.

Random quote: We are in politics not because we hate our fellow man, but because we love him. ~ Anton Weinreich, General Secretary of the Dorvish Communist Part

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 52