Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5492
Next month in: 01:59:17
Server time: 06:00:42, June 02, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Cooperative Commonwealth Federation[?]

This page contains information about the Cooperative Commonwealth Federation.

This party is inactive.

Details

User[?]: RomeoII

Nation[?]: Kongeriket av Kazulmark (Kazulia)

Seats[?] in Storting[?]: 0

Color[?]:

 

Description[?]:

July 2456

The Kaluzia Independent Party or KIP was formed to meet a broad rainbow of interests of all of its members. The KIP is like no other political party in Kaluzia as it is a centrist political party with right-wing aspects and left-wing aspects of it trying to work together in the (socialist) Democratic Republic of Kaluzia.

Head of Party;

Danielle Arbour July 2456 - July 2469
John Damon Troff August 2469 - August 2474
Jeremy Mallenby September 2474 -

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristhighperfect
Civil Rightsmoderate restrictivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaningclose to noneperfect
Government Responsibilitiesmoderate big governmenthighperfect
Marketextreme regulatorhighperfect
Militarypacifist-leaninglimitedperfect
Moralitymoderate progressivemoderateperfect
Religionmoderate secularhighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
July 245911,429,16187,695,29113.03+13.039975013.20+99
October 246110,287,18487,479,45511.76-1.278975011.87-10
April 24649,876,94889,758,31111.00-0.768275010.93-7
February 246616,530,05392,166,89917.93+6.9313475017.87+52
August 246811,203,18893,756,06411.95-5.998975011.87-45
February 24708,607,05392,031,3179.35-2.60707509.33-19
August 247210,487,37395,570,62510.97+1.628275010.93+12
September 247412,198,90297,120,89712.56+1.599575012.67+13
March 24779,083,23598,510,2129.22-3.34697509.20-26
September 247911,498,570100,996,55311.39+2.168575011.33+16

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Cooperative Commonwealth Federation.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471

BillCreatedVoting startedVoteBill StatusResult
MP Moral Bill 4314May 4314February 4315passed
2nd Cabinet Proposal May 4314 AlliansenMay 4314June 4314defeated
R.I.4314 Töffting leaves the animals aloneMarch 4314December 4314passed
R.I.4314 Töffting leaves the kids aloneMarch 4314December 4314defeated
4314 GR ManifestoJanuary 4314November 4314defeated
Cabinet Proposal of December 4313December 4313December 4313passed
Kjerne Election Manifesto 4313March 4313March 4313defeated
MP Health Bill 4312November 4312November 4312passed
Call for early elections, June 4312June 4312June 4312defeated
R.I.4312 Dissolution of patentismJune 4312June 4312defeated
R.I.4312 Cultural federalism actJune 4312June 4312passed
Cabinet Proposal of November 4311November 4311December 4311defeated
P.I. 4311 - Foreign Policy ActNovember 4311November 4311defeated
P.I. 4311 - Technology ActNovember 4311November 4311defeated
R.I.4311 Federal law recognitionOctober 4311October 4311passed
R.I.4311 Freedom of employment 5September 4311September 4311passed
R.I.4311 Freedom of investmentAugust 4311August 4311passed
R.I.4311 Competitive Kazulia.August 4311August 4311defeated
R.I. 4311 Boge Waste and Eminent Domain ReformsJune 4311February 4312passed
R.I.4311 Competition in the pharmaceutical industryJune 4311September 4311passed

Random fact: There is a phpBB forum dedicated to Particracy. Please click the Forum link in the top game menu. Additions to the game, suggestions and discussion is held there so get involved. http://forum.particracy.net/

Random quote: "Let's call the drug war what it is, ethnic cleansing of Americans." - Jello Biafra

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51