Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5573
Next month in: 03:12:33
Server time: 16:47:26, November 24, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Revoluţie Partid[?]

This page contains information about the Revoluţie Partid.

This party is inactive.

Details

User[?]: Gjulz

Nation[?]: Republica Chizână (New Endralon and Kizenia)

Seats[?] in Parlamentul Republicii (Republic's Parliament)[?]: 0

Color[?]:

 

Description[?]:

We advance a platform of strong economic policy, feeling that private enterprise should be allowed to function in society, but the government should be very present in any moment.

We advance basic civil rights for everyone, and equal rights are for all.

We aren't for an aggressive policy of national defence.

We are for low standards of moral decency.

We don't hate "homosexuality" .

Most importantly, we are opposed to Fascism as it is simply a baseless, lie-filled ideology of hate and intolerance, only interested on maintaing itself over the needs of the common man. We will do everything to remove fascists around the world, by any means necessary.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsrestrictive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalistlimitedperfect
Government Responsibilitiesmoderate big governmenthighperfect
Marketmoderate regulatormoderateperfect
Militarymoderate pacifistlimitedperfect
Moralityconvinced progressivemoderateperfect
Religionconvinced secularlimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
March 240460,88779,117,6100.08+0.0806660.00+0
May 240736,28778,171,0790.05-0.0306660.00+0
July 24107,457,62478,279,0249.53+9.48646669.61+64
September 241311,245,78278,991,74614.24+4.719566614.26+31
November 24169,117,76880,600,44911.31-2.927666611.41-19
January 24206,621,94477,309,3998.57-2.75566668.41-20
January 24226,854,48177,863,4628.80+0.24424998.42-14
January 24248,678,32778,556,97811.05+2.245449910.82+12
January 242618,317,38677,421,75923.66+12.6111949923.85+65
January 242820,098,44283,583,06024.05+0.3912149924.25+2
January 243012,547,50083,325,56415.06-8.997549915.03-46
January 243213,470,11186,149,64115.64+0.587749915.43+2
January 243413,259,36184,828,84815.63-0.007849915.63+1
January 24387,424,87489,033,2618.34-7.29414998.22-37
January 24406,743,58889,160,3997.56-0.78374997.41-4
February 24427,827,41383,611,3809.36+1.80464999.22+9
May 24448,363,77585,633,4869.77+0.41494999.82+3
June 24461,964,37587,216,5112.25-7.51114992.20-38
June 24505,532,65791,067,6266.08+3.82294995.81+18
June 24526,475,77791,418,2947.08+1.01354997.01+6
June 24546,218,70086,698,6527.17+0.09344996.81-1
June 24566,738,33787,250,0657.72+0.55374997.41+3
June 24588,076,74187,380,5519.24+1.52454999.02+8
June 24606,733,17093,622,5967.19-2.05354997.01-10
June 24629,654,21091,589,56710.54+3.355349910.62+18
June 24649,232,09888,939,28910.38-0.165249910.42-1
June 246610,893,95289,240,69512.21+1.836249912.42+10
June 24689,380,40787,960,68710.66-1.545249910.42-10
June 247022,800,82995,216,41023.95+13.2812349924.65+71
June 247219,611,57188,660,08622.12-1.8311249922.44-11
June 247420,536,93187,544,93423.46+1.3411949923.85+7
June 247620,620,68188,098,84223.41-0.0511849923.65-1
June 247822,814,72698,869,16423.08-0.3311649923.25-2
June 248015,986,47393,955,21117.01-6.068549917.03-31
March 277238,574,498219,044,22717.61+0.605230017.33-33
March 277860,558,644193,104,07831.36+13.759730032.33+45
March 278460,577,440187,491,63532.31+0.959830032.67+1

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Revoluţie Partid.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387

BillCreatedVoting startedVoteBill StatusResult
RP: National Framework For Tripartism (New Players, Please Read)January 4447March 4462defeated
Central Bank ActJanuary 4447June 4447defeated
National Framework For Tripartism ActJanuary 4447February 4447passed
Ecology BillDecember 4446June 4447defeated
Religious Clothing ActDecember 4446June 4447passed
Termination of Pregnancy ActDecember 4446June 4447defeated
Treatment of Prisoners of War BillDecember 4446February 4447defeated
Domestic Agriculture (Support & Protection) ActDecember 4446February 4447passed
Monuments & Places of National Importance ActDecember 4446February 4447passed
Infrastructure Enhancement (Eminent Domain Package) ActDecember 4446February 4447passed
Budget proposal of December 4446December 4446December 4446passed
Income tax proposal of December 4446December 4446December 4446passed
Call for early elections, September 4446September 4446June 4447defeated
Death Penalty [Abolishment ] ActSeptember 4446June 4447defeated
National Service ActSeptember 4446June 4447defeated
Political Education ActSeptember 4446June 4447passed
Dueling ActSeptember 4446June 4447defeated
National Civil Liberties ActJuly 4446February 4447passed
Our ManifestoFebruary 4446February 4446defeated
Retirement Adequacy ActJanuary 4446February 4447passed

Random fact: Real-life quotations may be used in Particracy, but the real-life speaker or author should always be referenced in an OOC (out-of-character) note alongside the quotation.

Random quote: "Erotic politicians, that's what we are. We're interested in anything about revolt, disorder, chaos and activity that appears to have no meaning." Jim Morrison

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51