Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: January 5480
Next month in: 00:41:52
Server time: 19:18:07, May 07, 2024 CET
Currently online (4): AethanEge | HopesFor | LC73DunMHP | luthorian3059 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Welsh Eudaimonic Party[?]

This page contains information about the Welsh Eudaimonic Party.

This party is inactive.

Details

User[?]: 6underground

Nation[?]: Gran Prinċipat ta’ Kildanja (Cildania)

Seats[?] in Kunsill tad-Deputati (Council of Deputies)[?]: 0

Color[?]:

 

Description[?]:

The Welsh Eudiamonic Party objectives are to carry out and sustain the ideological belief of an Eudiamonic society. The term Eudiamonia stems from an classical Greek word coined by the great philisopher Socrate's and announced through his protege, Plato in his dialogues.

Eudiamonia comprises two words from Greek language, "Eu" - good and well being, and "daimon" - Spirit or minor diety.

Eudaimonia is constituted, according to Aristotle, not by honor, or wealth, or power, but by rational activity in accordance with excellence. Such activity manifests the virtues of character, including courage, honesty, pride, friendliness, and wittiness; the intellectual virtues, such as rationality in judgment; and it also includes non-sacrificial (i.e., mutually beneficial) friendships and scientific knowledge.

It is therefore the parties objective to completely revolutionise and transcend social models and to establish the first form of Human "utopia" on the planet.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsrestrictive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate isolationistlimitedperfect
Government Responsibilitiessmall government-leaningclose to noneperfect
Marketconvinced regulatorclose to noneperfect
Militarymoderate militaristlimitedperfect
Moralitymoderate progressivemoderateperfect
Religionconvinced secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
February 219621,40837,846,3580.06+0.0604250.00+0
February 21991,385,82039,841,7883.48+3.42164253.76+16
February 22022,233,17539,995,5665.58+2.11244255.65+8
February 22051,988,57140,242,1484.94-0.64214254.94-3
February 22082,125,51441,053,4525.18+0.24224255.18+1
July 22091,931,54237,657,9845.13-0.05214254.94-1
July 22122,503,71338,769,7346.46+1.33274256.35+6
July 22152,762,30338,704,0297.14+0.68294256.82+2
July 22182,543,05539,567,8376.43-0.71274256.35-2
July 22212,654,39640,096,8616.62+0.19284256.59+1
July 22247,082,73837,500,32118.89+12.278142519.06+53
July 22279,103,66043,725,14120.82+1.938942520.94+8
July 22303,473,16144,251,4627.85-12.97334257.76-56
July 22332,718,33244,283,8596.14-1.71254255.88-8
July 22362,721,18042,166,3196.45+0.32264256.12+1
July 22392,500,44943,867,9275.70-0.75234255.41-3
April 22422,272,39541,835,2545.43-0.27214254.94-2

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Welsh Eudaimonic Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448

BillCreatedVoting startedVoteBill StatusResult
Recreational Drug Use ActJanuary 2156January 2156passed
Divorce Rights Act of 2155September 2155September 2155passed
Military Reform ActAugust 2155August 2155passed
Contraception Availability ActApril 2154April 2162passed
Educational Reform BillMarch 2154March 2154passed
Intelligence reform billMarch 2154March 2154passed
Private Education Reform ActJanuary 2154January 2154defeated
Abortion Reform ActOctober 2153October 2153defeated
Military Expansion ActJune 2153June 2153defeated
Police Reform ActMay 2153May 2153passed
Stable Government ActDecember 2152December 2152defeated
Religious School Act 2152December 2152December 2152defeated
Military Reform ActNovember 2152November 2152defeated
Civil Rights Entrechment ActOctober 2151October 2151defeated
End of Wasteful Spending Proposal # 1June 2151June 2151defeated
Broad Nation ProposalJune 2151June 2151passed
Eminent Domain Reform ActMay 2151May 2151passed
Privacy Protection ActApril 2151April 2151defeated
Alcoholic Beverage ResolutionJanuary 2151January 2151passed
Fishing and Hunting Bill 2150November 2150November 2150defeated

Random fact: Particracy is completely free! If you want to support the game financially, feel free to make a small donation to the lievenswouter@gmail.com Paypal account.

Random quote: "Those who expect to reap the blessing of freedom must, like men, undergo the fatigue of supporting it. " - Thomas Paine

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51