Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: August 5490
Next month in: 00:13:40
Server time: 23:46:19, May 28, 2024 CET
Currently online (1): Dx6743 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Progressive Socialist Party[?]

This page contains information about the Progressive Socialist Party.

This party is inactive.

Details

User[?]: Voncken1996

Nation[?]: Commonwealth of Lodamun (Lodamun)

Seats[?] in National Congress[?]: 0

Color[?]:

 

Description[?]:

The Progressive Socialist Party (PSP) is a party created in March 3398, that was created after the pre-existing social movement known as the 'Socialist Progressive Movement', decided to take matters in their own hand and stand for election. The PSP stands for leftist and progressive values, striving to create a socialist state that provides equality and possibility for everyone, while ensuring the future of Lodamun
======================================================

Positions

Foreign Affairs
The PSP find Foreign Affairs of utmost importance. Too long has Lodamun been isolationist and inward looking, and we want to change that. This includes the drive to seek accession to more international bodies and organizations that can improve the international standing of Lodamun. Furthermore we want Lodamun to take a stand against global poverty and further the global standard of living.

Internal Affairs:
Concerning internal affairs we believe both in the freedom of the individual, as well as the state being a guarantor of collective goods. Therefore we want to limit laws that impede individual freedoms (as exemplified by the 'Freedom of Body Act' we passed), while letting the state control important avenues such as providers of electricity, water and public transport, as everyone should have equal access to those.

Finance
Lodamun should be financially stable enough, but a deficit could be run when this is necessary for the national good.

Defence
We need a functioning military that is capable of defending Lodamun, but it should not be interventionist. Furthermore the PSP is against any investments in biological, chemical or nuclear warfare. We are also against internationally frowned upon military measures, such as land mines.

Justice:
Concerning Justice, the PSP believes in a system fully based on rehabilitation. While we understand the idea that people should be punished for their deeds, we do not believe just locking them up has any use. Therefore we focus on rehabilitation, so that convicts can once again become valued members of Lodamunese society. For those who committed the heaviest crimes and those with mental issues, we support a well-funded prolonged custody with access to psychiatrists.

Infrastructure and Transport:
We believe that the state plays a pivotal role in providing these services for its people. Therefore the PSP wants the government to control public transport and subsidize access to it, so anyone can make use of this service. Furthermore we hope that large investments in public transport will de-incentivize people to take the car, which will lead to less pollution.

Health and Social Service:
Health is a public service, to which each citizen has a right. Therefore we of the PSP believe in a fully nationalized health service with full and equal access for all its citizens. Furthermore we believe in the full coverage of both preventive birth control and abortion, to guarantee the free choice of women.

Education and Culture:
We believe the state should fund public schools and guarantee that all people have access to quality education. Therefore we believe in a strong schooling system and a national curriculum that is given in all schools, and prepares students for participating in Lodamunese society.


Food and Agriculture
We believe that food standards should be guaranteed by the government and that output should be controlled by quota's. as to not flood the market nor damage natural resources.

Environment and Tourism
The PSP is strong on environmental protections. We acknowledge the damage that humans do in the way of carbon emissions, and see the duty of government to cut carbon emissions effectively and quickly.

On Tourism, we believe that an open and welcoming attitude and accessible borders promote tourism, and believe in a structured and strong tourism sector due to the beauty of Lodamun, as long as we keep it that way.

Trade and Industry

the PSP believes in controlled trade, where the Presidium can take measures against excesses of any sort. However, we are not unnecessarily protectionist, and are willing to enter agreements that limit trade barriers.

We believe in our lodamunese industry, and that they can provide for many. But also here we need to limit the excesses, to combat climate change.


=====================================================

Party Leaders*

Luuk Voncken: 3398 - 4426
James McAvoy: 4426 - 4433
Sophie Hill 4433 - 4453
Harry Mardoval 4453 - current

Presidents
Luuk Voncken 4426-4428
Sophie Hill 4453 - current


*= When a Party Leader is part of the cabinet a parliamentary leader will be elected internally after the coalition cabinet is sworn in.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightsmoderate permissivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiesmoderate big governmentmoderateperfect
Marketconvinced regulatormoderateperfect
Militarymoderate pacifistmoderateperfect
Moralityconvinced progressivemoderateperfect
Religionconvinced secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
May 44017,460,92644,184,38916.89+16.8910159916.86+101
May 44057,736,69047,678,94316.23-0.6610059916.69-1
April 440712,239,31745,370,71526.98+10.7516459927.38+64
April 441110,738,71954,454,15119.72-7.2612059920.03-44
October 441412,495,34062,854,59219.88+0.1612059920.03+0
October 44189,728,28858,047,34616.76-3.1210359917.20-17
October 44229,634,12962,961,21115.30-1.469259915.36-11
October 44266,746,42259,347,63911.37-3.936759511.26-25
May 44289,455,78259,759,17615.82+4.469559515.97+28
May 443210,165,08663,664,86615.97+0.149559515.97+0
August 44338,324,38061,706,52813.49-2.488259513.78-13
August 443711,486,48861,840,18618.57+5.0811259918.70+30
August 444113,282,94660,193,00122.07+3.4913259922.04+20
August 444515,924,27559,775,37126.64+4.5715859926.38+26
August 444915,860,69761,905,06525.62-1.0215259925.38-6
August 445313,690,70756,942,09424.04-1.5814459924.04-8
August 44578,905,89162,001,64214.36-9.688559914.19-59

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Progressive Socialist Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593

BillCreatedVoting startedVoteBill StatusResult
National Unity CabinetDecember 2818December 2818defeated
Fire Deptarment Act 2818August 2818July 2820defeated
Income tax proposal of March 2818March 2818March 2818defeated
Likatonia Land Mines ActFebruary 2818February 2818passed
Health Care System Reform ActFebruary 2818February 2818passed
Farming Chemicals Regulation ActFebruary 2818February 2818passed
Farm Subsidies Elimination ActFebruary 2818February 2818passed
Sexual Morality ActFebruary 2818February 2818defeated
Eminent Domain Reform ActFebruary 2818February 2818passed
State Welfare Reform ActFebruary 2818February 2818defeated
Public Pension Reform ActFebruary 2818February 2818passed
Animals Bill of 2818February 2818February 2818passed
Health Bill of 2818February 2818February 2818passed
Economics Bill of 2818February 2818February 2818defeated
Defense Subsidies Reform ActAugust 2817August 2817defeated
Nuclear Deterrence Capabilities Reform ActJuly 2817August 2817defeated
Women in the Military BillJuly 2817July 2817passed
Landmines BillJuly 2817July 2817passed
Budget proposal of July 2817 - Defence CutsJuly 2817July 2817passed
Local Communities Know BestFebruary 2817February 2817defeated

Random fact: Real-life religions should not be referenced in Particracy. Terra has its own religions, many of which mirror real-life ones. See: http://particracy.wikia.com/wiki/Illustrated_Catalogue_of_Religion

Random quote: "I have no faith in political arithmetic." - Adam Smith

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 55