Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: April 5479
Next month in: 03:53:41
Server time: 04:06:18, May 06, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Akigan Patriot Partei[?]

This page contains information about the Akigan Patriot Partei.

This party is inactive.

Details

User[?]: Shreminov

Nation[?]: Voronan Federation (Vorona)

Seats[?] in Federal Parliament[?]: 0

Color[?]:

 

Description[?]:

The Patriot Party is a popular movement created by many citizens in order to effectively seize power and end the anarchy reigning in Deltaria Nova back when no government ruled over the nation. It is now the biggest party in the nation.

Ideology:
Green conservatism (but can be progressive)
Nationalism

OOC: The weird game mechanic says we're skeptic ecologically, but I assure you: we're not.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsmoderate permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketmoderate regulatormoderateperfect
Militaryconvinced militaristmoderateperfect
Moralityconservative-leaningmoderateperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
November 456321,780,47221,807,39299.88+99.88390390100.00+390
November 45677,356,64825,079,26229.33-70.5411239028.72-278
September 45702,376,54722,460,38510.58-18.754239010.77-70
April 45721,330,50922,596,2835.89-4.69243906.15-18
October 45742,729,22323,453,26211.64+5.754639011.79+22
October 45783,525,12623,688,06314.88+3.245539014.10+9
October 45825,832,82825,297,07523.06+8.189039023.08+35
January 45864,642,81824,979,88218.59-4.477239018.46-18
January 45908,387,21216,119,14852.03+33.4520439052.31+132
August 45936,344,12915,330,29141.38-10.6516239041.54-42
December 45957,771,88716,553,13446.95+5.5718339046.92+21
December 45987,414,54616,434,53045.12-1.8417639045.13-7
April 46016,997,76315,244,33845.90+0.7917939045.90+3

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Akigan Patriot Partei.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326

BillCreatedVoting startedVoteBill StatusResult
Immigration Act 4134November 4134November 4134passed
Eminent domain Reform 4134October 4134November 4134passed
Family Values Act 4134October 4134October 4134passed
Civilian Policing Act of 4135June 4134June 4134defeated
Local Government ActJune 4134June 4134defeated
Call for early elections, January 4134January 4134June 4134defeated
Free and Independent Media Act of 4134January 4134February 4134defeated
Civil Liberties Act of 4134January 4134February 4134defeated
Energy Reform 4134October 4133June 4134passed
STICKY: Economic data (updated 4165)June 4132December 4235defeated
STICKY: RP lawsJune 4132December 4235defeated
STICKY: Cultural information, demographics, etc.June 4132December 4235defeated
STICKY: Information for new playersJune 4132December 4235defeated
Currency Reevaluation and budget proposal of June 4132June 4132June 4132passed
National Animal Restoration 4132June 4132June 4132passed
Banking and Monetary Reform 4133May 4132October 4133passed
Protectionist Measures 4133May 4132October 4133passed
Vorona First 4132May 4132December 4132passed
Higher Education Reform 4132May 4132May 4132passed
Preschool and Nursery Privatization 4132May 4132May 4132passed

Random fact: Information about the population of each country can be found on the Population Information thread: http://forum.particracy.net/viewtopic.php?f=5&t=8663

Random quote: "A countryman between two lawyers is like a fish between two cats." - Benjamin Franklin

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51