Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: January 5486
Next month in: 02:39:23
Server time: 17:20:36, May 19, 2024 CET
Currently online (6): GLNBei | Infinite | Ost | R Drax | ReddyKafuri | SocDemDundorfian | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


共產黨 (Communist Party)[?]

This page contains information about the 共產黨 (Communist Party).

This party is inactive.

Details

User[?]: megtehetem25

Nation[?]: Yingdala Datong (Yingdala)

Seats[?] in 大会 (Grand Assembly)[?]: 0

Color[?]:

 

Description[?]:

The Communist Party is a communist political party, founded by Xuan Yong.

General Secretary: Xuan Yong

Main goals of the Communist Party:

- Estabilishing a People's Republic
- Anti-monarchy
- Strong central government
- Equality

Wiki page: https://bit.ly/2k6cI4l
Anthem: https://www.youtube.com/watch?v=X9pGTOlhRvs

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristhighperfect
Civil Rightsmoderate restrictiveexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalistmoderateperfect
Government Responsibilitiesmoderate big governmentexcellentperfect
Marketmoderate regulatorhighperfect
Militaryextreme militaristmoderateperfect
Moralityprogressive-leaninghighperfect
Religionmoderate secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
January 463227,38012,035,4910.23+0.2307500.00+0
December 46321,539,47311,662,51113.20+12.9710175013.47+101
December 46343,189,79443,315,5397.36-5.847975010.53-22
August 463511,682,44211,723,03199.65+92.29750750100.00+671
September 46375,722,46632,506,99717.60-82.0513275017.60-618
September 464227,498,61144,997,99461.11+43.5131752560.38+185

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the 共產黨 (Communist Party).

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418

BillCreatedVoting startedVoteBill StatusResult
Deregulation of Civil Freedom ActOctober 4210March 4211passed
Reverse of Corporation Tax BillAugust 4210March 4211defeated
National Security ActAugust 4210March 4211defeated
Traditional New Year Celebration ActDecember 4209February 4211passed
National Health Services ActDecember 4209February 4211passed
Reproductive Rights ActDecember 4209February 4211passed
Budget proposal of February 4209February 4209November 4209passed
Abolishment of Eminent Domain and the Protection of Private Property ActJanuary 4209June 4209defeated
Center-Left Cabinet Proposal of October 4208October 4208October 4208passed
Nuclear-Free Yingdala Act of 4208August 4208February 4209passed
Filial Devotion ActAugust 4208February 4209passed
Good Corporate Citizenship ActAugust 4208February 4209passed
Progressive Income Tax ActAugust 4208February 4209passed
Grand Assembly Seat Adjustment ActAugust 4208February 4209defeated
Promotion of National Arts and Cultural Heritage ActAugust 4208February 4209passed
Better Water Quality BillMarch 4208September 4208defeated
Child Protection ActJanuary 4208August 4208passed
Financial Responsibility ActJanuary 4208August 4208passed
The Animal Protection ActJanuary 4208June 4208passed
Center and Center-Left Cabinet Proposal of January 4208January 4208January 4208defeated

Random fact: Don't vote yes on a cabinet coalition that doesn't give you the power that you deserve.

Random quote: "The honest politician is one who, when he is bought, stays bought." - Simon Cameron

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51