Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: July 5477
Next month in: 01:56:58
Server time: 02:03:01, May 01, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


National Bolshevik Party[?]

This page contains information about the National Bolshevik Party.

This party is inactive.

Details

User[?]: Pluto

Nation[?]: Ikradonian Union (Ikradon)

Seats[?] in Federale Kamer (Federal Chamber)[?]: 0

Color[?]:

 

Description[?]:

The Communist Manifesto (some of these points may already be accomplished):

1. Abolition of property in land and application of all rents of land to public purposes.

2. A heavy progressive or graduated income tax.

3. Abolition of all right of inheritance.

4. Confiscation of the property of all emigrants and rebels.

5. Centralization of credit in the hands of the State, by means of a national bank with State capital and an exclusive monopoly.

6. Centralization of the means of communication and transport in the hands of the State.

7. Extension of factories and instruments of production owned by the State; the bringing into cultivation of waste-lands, and the improvement of the soil generally in accordance with a common plan.

8. Equal liability of all to labour. Establishment of industrial armies, especially for agriculture.

9. Combination of agriculture with manufacturing industries; gradual abolition of the distinction between town and country, by a more equable distribution of the population over the country.

10. Free education for all children in public schools. Abolition of children's factory labour in its present form. Combination of education with industrial production, etc.

http://www.freewebs.com/national-bolshevik/

Red Guard Member Count: 2,419,730

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristexcellentperfect
Civil Rightsmoderate restrictiveexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced isolationisthighperfect
Government Responsibilitiesmoderate big governmentexcellentperfect
Marketfanatical regulatorexcellentperfect
Militaryconvinced militaristmoderateperfect
Moralityconservative-leaninghighperfect
Religionconvinced secularexcellentperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
September 252367,228111,171,3340.06+0.0605990.00+0
March 252721,270,099113,380,64618.76+18.7011359918.86+113
September 252731,257,355110,209,85228.36+9.6017159928.55+58
March 253113,241,689109,102,10312.14-16.227559912.52-96
September 253414,049,734106,795,71813.16+1.028159913.52+6
March 253816,596,390106,839,54315.53+2.389459915.69+13
December 253817,686,838108,294,87316.33+0.8010059916.69+6
December 254020,503,149107,407,86319.09+2.7611459919.03+14
December 254226,234,959109,354,16623.99+4.9014559924.21+31
December 254426,835,198118,161,30922.71-1.2813759922.87-8
December 254622,378,598112,251,09819.94-2.7712159920.20-16
December 254824,021,388112,171,77221.41+1.4813059921.70+9

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the National Bolshevik Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383

BillCreatedVoting startedVoteBill StatusResult
Trade Union Act 2343September 2343June 2344passed
Economic Freedom Act 2343September 2343June 2344defeated
Covert Operations Act 2343June 2343June 2344passed
Monetary Damages Reform BillJuly 2342August 2343defeated
Military Rerform Act 2342July 2342June 2343passed
Nuclear Disarmanent ActJanuary 2342March 2343passed
Ratification of the The Artanian AllianceAugust 2341May 2344defeated
Anti-Riot ActJuly 2340March 2342defeated
Welfare Reform Act 2340July 2340February 2342passed
Privacy Act 2340July 2340February 2341passed
Immigration Liberalisation BillJuly 2340November 2340passed
Income tax proposal of May 2340May 2340February 2342passed
Cabinet Proposal of February 2339February 2339February 2339passed
Say No To Big Brother Government BillOctober 2338February 2339passed
Devolution of Democracy BillOctober 2338February 2339passed
Free Trade For Free People BillOctober 2338February 2339defeated
Religious Education Reform BillJanuary 2338October 2338defeated
Privatisation of Social Security BillJanuary 2338September 2338defeated
Public Transportation Funding Reform BillJanuary 2338September 2338defeated
Eminent Domain Reform BillDecember 2337October 2338passed

Random fact: Particracy does not allow role-play that seems to belong to the world of fantasy, science fiction and futuristic speculation.

Random quote: "Hunger makes a thief of any man." - Pearl S. Buck

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51