Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5478
Next month in: 00:57:43
Server time: 23:02:16, May 03, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Jakania Islamic Nationalist Party[?]

This page contains information about the Jakania Islamic Nationalist Party.

This party is inactive.

Details

User[?]: Liberi

Nation[?]: Cakaniye Cumhuriyeti (Jakania)

Seats[?] in Cumhuriyet Meclisi (Assembly of the Republic)[?]: 0

Color[?]:

 

Description[?]:

The Jakania Islamic Nationalist Party is founded on 5 fundamental beliefs:

-Strong Government
-Nationalism
-International Good Will
-Militarism
-Islam


Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsmoderate restrictivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketmoderate regulatormoderateperfect
Militaryconvinced militaristlimitedperfect
Moralityconservative-leaninglimitedperfect
Religionmoderate religiouslimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
July 256154,313141,474,1490.04+0.0403500.00+0
July 2564570,974134,235,5530.43+0.3913500.29+1
July 25674,011,638132,815,7113.02+2.6093502.57+8
July 257014,720,269132,192,76511.14+8.123935011.14+30
July 257325,000,288127,744,71019.57+8.446935019.71+30
July 257624,400,647125,361,59719.46-0.116835019.43-1
July 257922,043,826126,601,38017.41-2.056135017.43-7

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Jakania Islamic Nationalist Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306

BillCreatedVoting startedVoteBill StatusResult
DWC ActJune 2449November 2449passed
Phone Services ActJune 2449November 2449defeated
Advertising ActJune 2449July 2449defeated
School Discipline ActJune 2449July 2449defeated
Weapons of Mass Destruction ActMarch 2449June 2449defeated
Higher Education BillMarch 2449June 2449defeated
Clean Energy BillMarch 2449June 2449defeated
Religious Schools BillMarch 2449June 2449defeated
Pharmaceutical Industry Regulation ActSeptember 2448March 2449defeated
Eminent Domain BillAugust 2448March 2449defeated
Military billMarch 2448May 2448passed
Accord des Nations AmicalesJuly 2446September 2473defeated
Public NudityOctober 2445October 2445defeated
Flag Desecration LawOctober 2445October 2445passed
Jakanian Re-EducationAugust 2445August 2445passed
Childrens Protection ActJune 2445June 2445defeated
Gambling LawMarch 2445March 2445defeated
Child LaborMarch 2445March 2445defeated
Redefining Justice in Jakania Part 4February 2445February 2445defeated
Redefining Justice in Jakania Part 3February 2445February 2445defeated

Random fact: When forming a cabinet, try to include as few parties as possible, while still obtaining a majority of the seats.

Random quote: “The people's war isn't just a war of destruction, it is also a war of construction. We will build new facilities, new hospitals, new farms. We will seek to improve the lives of the people around us. This struggle will be as costly as the struggle against the bourgeois army, and indeed will be even more damaging to the enemy.” - Comrade X, former Hulstrian politician

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51