Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5487
Next month in: 00:17:55
Server time: 03:42:04, May 23, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Les Conservateurs[?]

This page contains information about the Les Conservateurs.

This party is inactive.

Details

User[?]: Gates

Nation[?]: État d'Aldurie (Alduria)

Seats[?] in Assemblée Nationale[?]: 0

Color[?]:

 

Description[?]:

The Grand Party of Aldurie From 4204 to 4206
Le Parti Conservateur From 4212 to 4214
Le Parti Travailliste Aldurien (PTA) from 4214 to 4215
Les Republicain from 4215 till 4235
Les Conservateurs from 4235 till now

Leader of the Party
-Victoria Gates from 4204 to 4206(Resigned)
-Victoria Assarone from 4212 till 4224(Retired)
-Georgia DuRole 4224(Resigned)
-Diane Quentin from 4224 till 4234(Retired)
-Philip Cotiare from 4234 till 4237(Resigned)
-Ilonna Tomas 4237 till 4248(Retired)
-Nicolas Jauffret 4248 till 4255(Retired)
-Céline Du Toit 4268 till 4292 (longest serving Prime Minister)
-Interim leader Natanaël Crozier 4292 till 4318
-Intérim Leader Aline Riquetil 4318 till now

President of The 1st Republic
-Victoria Assarone from 4212 to 4224
-Diane Quentin from 4225 till 4235

President of the République Fédérale
-Léonard Nicollier

Governments
- President Victoria Assarone's Government From 4219 till 4224 (majority)
- President Diane Quentin's Government From 4225 till 4235(BA coalition)
- Prime Minister Cotiare's Government From 4235 till 4237(BA coalition)
- Prime Minister Tomas' 1st Government From 4240 to 4243(NCP coaliion)
- Prime Minister Tomas' 2nd Government Frome 4243 to 4248(PLBS coalition)
- Prime Minister Jauffret's 1st Government From 4248 to 4250(PLBS Coalition)
- Prime Minister Jauffret's 2nd Government From 4250 till 4353(BA Coalition)
- Prime Minister DuToit 1st Government From 4268 till 4292 (total seats)
- Prime Minister Natanaël Crozier 1st Government in 4292

[B]Opposition[/B]
-from 4204 till 4206
-from 4212 till 4219
-Temporarily in 4235
-From 4237 to 4240
-From 4253 till 4254
-From 4319 till now

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate federalistmoderateperfect
Civil Rightsmoderate restrictivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketregulator-leaningmoderateperfect
Militaryconvinced militaristmoderateperfect
Moralityconvinced conservativemoderateperfect
Religionmoderate religiousmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
March 420448,74362,118,1680.08+0.0807500.00+0
March 420625,054,85561,442,97140.78+40.7030675040.80+306
March 421228,846,14166,975,09343.07+2.2932475043.20+18
March 421425,949,98666,756,93338.87-4.2029375039.07-31
December 421530,134,95462,908,43647.90+9.0321143548.51-82
December 421731,516,86665,964,94947.78-0.1221043548.28-1
December 421936,224,90266,679,70354.33+6.5523643554.25+26
February 422036,274,49567,031,30754.12-0.2123743554.48+1
February 422237,413,83665,686,32056.96+2.8424843557.01+11
January 422426,386,19662,860,94741.98-14.9818243541.84-66
December 422523,585,62365,081,04936.24-5.7415943536.55-23
December 422917,805,95554,832,32732.47-3.7716350132.53+4
May 423019,406,32154,998,45935.29+2.8117650135.13+13
May 423421,915,92062,617,47035.00-0.2917650135.13+0
December 423522,194,62564,194,93134.57-0.4322565034.62+49
December 424016,315,13260,390,63227.02-7.5617865027.38-47
December 424214,562,83155,357,37326.31-0.7117265026.46-6
April 424321,993,76255,201,95539.84+13.5426065040.00+88
February 424825,175,22363,584,02739.59-0.2526365040.46+3
February 425314,491,42956,897,78125.47-14.1217065026.15-93
February 426822,723,71654,637,91141.59+16.1227465042.15+104
December 427011,729,90011,825,83499.19+57.60650650100.00+376
December 427212,279,52712,324,75299.63+0.44435435100.00-215
December 42766,478,38429,808,31921.73-77.909843522.53-337
December 42806,478,82123,581,72727.47+5.7412643528.97+28
December 428411,930,21211,983,94499.55+72.08435435100.00+309
May 428861,627,11361,738,94599.82+0.27435435100.00+0
May 429060,700,84660,802,47499.83+0.01750750100.00+315
May 429252,637,44559,162,74788.97-10.8667175089.47-79
May 429444,137,74754,571,78780.88-8.0961175081.47-60
October 431926,792,89257,686,47046.45-34.4335375047.07-258
October 432025,012,87359,847,43241.79-4.6531975042.53-34
October 432226,937,95661,851,23743.55+1.7632975043.87+10
October 432422,354,34664,967,68434.41-9.1426175034.80-68
October 432617,232,18061,271,84328.12-6.2821475028.53-47
October 432813,717,57263,176,37421.71-6.4116575022.00-49
December 43283,849,83436,688,38910.49-11.228675011.47-79
December 433014,175,24053,354,85026.57+16.0720175026.80+115
December 433218,292,80159,632,24030.68+4.1123075030.67+29
December 433424,199,60560,815,40239.79+9.1230275040.27+72
November 433523,272,39447,978,39548.51+8.7136875049.07+66
May 433815,440,95933,023,24746.76-1.7536175048.13-7
November 434022,178,64142,198,24952.56+5.8040075053.33+39
May 434316,757,96532,336,73251.82-0.7339875053.07-2

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Les Conservateurs.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517

BillCreatedVoting startedVoteBill StatusResult
National Health Care Service ActAugust 3477August 3477passed
Repeal of the Common Bill of Rights for the Holy Luthori Empire.August 3477August 3477passed
Ratification of the International Committee for Freedom in PontesiAugust 3477August 3477passed
Welfare ActAugust 3477August 3477passed
Termination of the Union with LuthoriJuly 3477August 3477passed
Budget proposal of February 3477February 3477February 3477passed
Industrial Relations Reform ActFebruary 3477February 3477passed
National Service (Abolition) ActFebruary 3477February 3477passed
Healthcare ActFebruary 3477February 3477passed
Elections ActJanuary 3477January 3477passed
Media Regulation ActAugust 3476August 3476passed
Digital Communications ActAugust 3476August 3476passed
General Infrastructure ActAugust 3476August 3476passed
Eminent Domain (Abolition) ActFebruary 3476February 3476passed
Public Employment Reform ActFebruary 3476February 3476passed
Budget proposal of February 3476February 3476February 3476passed
Capital Crimes (Abolition) ActFebruary 3476February 3476passed
Civil Rights ActFebruary 3476February 3476passed
Income tax proposal of September 3475September 3475September 3475passed
Economic Reform ActAugust 3475August 3475passed

Random fact: By default the head of government is the ultimate authority within a national government. In general terms, heads of government are expected to consult with cabinet colleagues (including those from other parties) before making significant decisions but they remain responsible for government action.

Random quote: "My tenure will be controversial and it is, quite obviously, true that I am the most right-wing Prime Minister this country has seen in several decades.” - Margaret Woodhall, former Dranian politician

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51