Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5573
Next month in: 01:20:16
Server time: 22:39:43, November 24, 2024 CET
Currently online (1): ImportantGuy | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


United Socialist Movement[?]

This page contains information about the United Socialist Movement.

This party is inactive.

Details

User[?]: Sam_b

Nation[?]: Hobratsuri Respublika (Hobrazia)

Seats[?] in Erovnuli Asamblea (National Assembly) [?]: 0

Color[?]:

 

Description[?]:

The United Socialist Movement are a party which fights to abolish poverty and capitalism. Our goal is to create a united socialist world, with freedom and equality for all. Solidarity with comrades around the world!

More information can be found at:

http://aiglesrv.no-ip.info:8080/particracy/wiki/index.php/United_Socialist_Movement

The USM paper, "Unite!", can be found at:

http://www.takeforum.com/forum/viewtopic.php?t=1205&mforum=particracy

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsmoderate permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsinternationalist-leaninglimitedperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketmoderate regulatormoderateperfect
Militarymoderate militaristlimitedperfect
Moralityconvinced progressivelimitedperfect
Religionmoderate secularlimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
December 2074708,91410,174,1076.97+6.974040010.00+40
April 20762,383,95718,928,31512.59+5.635140012.75+11
April 20791,930,59021,479,7108.99-3.61354008.75-16
April 20821,065,33621,821,4824.88-4.11174004.25-18
April 20851,871,19022,297,0918.39+3.51314007.75+14
April 20882,218,83822,352,1549.93+1.53394009.75+8
April 20892,339,66317,997,61713.00+3.075140012.75+12
April 20921,596,35614,231,37611.22-1.784540011.25-6
April 20951,072,97619,504,4065.50-5.72214005.25-24
April 20962,032,45021,389,0789.50+4.00384009.50+17
April 20992,437,70317,143,85614.22+4.725740014.25+19
July 20992,504,57716,085,84315.57+1.356340015.75+6
October 21002,743,25314,917,11718.39+2.827340018.25+10
October 21032,515,32416,994,06714.80-3.596040015.00-13
October 21065,001,63118,518,08327.01+12.2111240028.00+52
April 21075,417,28519,267,63628.12+1.1111640029.00+4
April 21104,951,43422,585,28421.92-6.199040022.50-26
October 21125,268,05922,722,22423.18+1.269440023.50+4
May 21154,004,80222,734,39917.62-5.577140017.75-23

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the United Socialist Movement.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349

BillCreatedVoting startedVoteBill StatusResult
Domesticated Pets ActApril 2368April 2368passed
Ecological Management ActApril 2368April 2368passed
Free Religion ActMarch 2368June 2368passed
Justice Reform ActMarch 2368June 2368defeated
Marriage as an Institution Abolition ActMarch 2368March 2368defeated
Energy Freedom ActMarch 2368March 2368defeated
Outlaw Corporal Discipline in SchoolsMarch 2368March 2368defeated
Cosmetic Animal TestingMarch 2368March 2368passed
Taxation ReductionMarch 2368March 2368defeated
Legalization of the Death PenaltySeptember 2367September 2367defeated
Repeal Eminent Domain PolicyAugust 2367February 2368defeated
Public Safety Act IIAugust 2367January 2368defeated
Use of TortureAugust 2367September 2367defeated
Choice in EducationOctober 2366April 2367defeated
Budget adjustment of October 2366October 2366April 2367defeated
Intellectual Property ActOctober 2366October 2366defeated
Tobacco ActOctober 2366October 2366passed
The Right to Property Act.October 2366October 2366defeated
Firearms Act II ReversionOctober 2366October 2366defeated
Budget adjustment of July 2366July 2366July 2366defeated

Random fact: In order for a Cabinet bill to pass, more than half of the legislature must vote for it and all of the parties included in the proposed Cabinet must support it. If your nation has a Head of State who is also the Head of Government, then the party controlling this character must also vote for the bill, since the Head of Government is also a member of the Cabinet. If any of these requirements are not met, the bill will not pass.

Random quote: "It is better to be feared than loved, if you cannot be both." - Niccolo Machiavelli

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51