Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5573
Next month in: 02:24:53
Server time: 17:35:06, November 24, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Imperiuli Nats’ionaluri Modzraoba[?]

This page contains information about the Imperiuli Nats’ionaluri Modzraoba.

This party is inactive.

Details

User[?]: Crassius

Nation[?]: Hobratsuri Respublika (Hobrazia)

Seats[?] in Erovnuli Asamblea (National Assembly) [?]: 0

Color[?]:

 

Description[?]:

The Imperiuli Nats’ionaluri Modzraoba (Imperial Nationalist Movement) is a new political party whose goal is to dismantle the current democratic institutions which have corrupted and weakened this country and to restore the former Hobrazian Empire!

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightspermissive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsextreme internationalistlimitedperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketregulator-leaninghighperfect
Militaryconvinced militaristlimitedperfect
Moralitymoderate progressivehighperfect
Religionconvinced secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
July 396110,077,88165,074,81315.49+15.497650015.20+76
July 396412,082,99360,096,41320.11+4.6210050020.00+24
July 396716,784,07453,716,31631.25+11.1415450030.80+54

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Imperiuli Nats’ionaluri Modzraoba.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349

BillCreatedVoting startedVoteBill StatusResult
Cabinet Proposal of October 2158October 2158October 2158passed
Porn regulation billSeptember 2158April 2159defeated
Reservation of the right to regulate import from international trade.September 2158October 2158passed
Return Power Generation Back to the Private Sector.August 2158August 2158passed
Let Our Foreigners Turned Citizens Stay Act.March 2158April 2158passed
Private Schools For The Kids Bill -2158-March 2158April 2158passed
Agricultural Subsidy Removal ActFebruary 2158December 2161passed
L-PU's Cabinet Proposal of February 2158February 2158February 2158defeated
Local Park Act.January 2158April 2158passed
Cabinet Proposal of January 2158January 2158January 2158defeated
Appendix to education reform billJanuary 2158January 2158defeated
Budget proposal of December 2157December 2157August 2158passed
Logging and Replantation Act 2157December 2157August 2158passed
Private Waste Freedom Act.December 2157February 2158defeated
Government Is Not Pure And The Like, Keep It Off From MediaDecember 2157December 2157passed
Lazy People Real Rights -2157-December 2157December 2157passed
The Death of Nationalised Industry Bill - 2157-.November 2157December 2157passed
Eminent Domain Repeal.September 2157December 2157defeated
Weapon exportation billAugust 2157October 2158defeated
Tax regulationAugust 2157October 2158defeated

Random fact: For more information on Particracy's former colonial nations, check out http://forum.particracy.net/viewtopic.php?f=5&t=6640

Random quote: "Democracy is more dangerous than fire. Fire can't vote itself immune to water." - Michael Z. Williamson

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51