Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: June 5563
Next month in: 03:17:10
Server time: 00:42:49, November 01, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Combination Unto Constitution[?]

This page contains information about the Combination Unto Constitution.

This party is inactive.

Details

User[?]: Irontide

Nation[?]: Communauté de Kanjor (Kanjor)

Seats[?] in Chambre des députés (Chamber of Deputies)[?]: 0

Color[?]:

 

Description[?]:

The Combination Unto Constitution is a society of equals working towards the recognition of the rights of the Kanjoran people and the restriction of governmental power to interfere in those rights. Having started out as a correspondance society, the Combination has grown into a stable and committed group of activists. The means through which the Combination wishes to accomplish this goal is through the charter of a comprehensive constitution ensuring the safety of each individual's sovereign right to govern his own life.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate federalistmoderateperfect
Civil Rightsmoderate permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketconvinced regulatormoderateperfect
Militarypacifist-leaningclose to noneperfect
Moralitymoderate progressiveclose to noneperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
January 218917,29034,138,5980.05+0.0503000.00+0
December 21922,798,63232,603,0318.58+8.53233007.67+23
June 21951,980,26333,069,0055.99-2.60173005.67-6
December 21976,202,84033,658,28618.43+12.446030020.00+43
June 22008,458,42734,349,53824.62+6.207630025.33+16
December 22028,903,06532,073,51227.76+3.138830029.33+12
June 22053,465,87535,125,1459.87-17.893030010.00-58
December 22074,876,55233,111,21314.73+4.864630015.33+16

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Combination Unto Constitution.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514

BillCreatedVoting startedVoteBill StatusResult
Acte de Déplacement de Subvention de ContraceptionMay 2502May 2502passed
The Sentiments of YoreMarch 2502March 2502defeated
Expanding Representation for the People of KanjorMarch 2502March 2502passed
Let Us Throw A Cog In The Wheel Of DemocracyFebruary 2502February 2502defeated
Em. DomainJanuary 2502January 2502passed
Hooker Act of December 2501December 2501December 2501defeated
Changing Unimportant Nationally Tried Standards (C.U.N.T.S.)September 2501September 2501defeated
Come on people, BE HAPPYSeptember 2501September 2501passed
National disarmamentMarch 2501May 2501defeated
FreedomsMarch 2501March 2501passed
Lois Morales 2500November 2500March 2501defeated
Actes de la Réforme de l'ArméeNovember 2500March 2501defeated
Export ActNovember 2500November 2500defeated
Freedom of the PressNovember 2500November 2500passed
Freedom of Speech ActNovember 2500November 2500passed
Rail PrivatisationNovember 2500November 2500defeated
Eminent Domain ActNovember 2500November 2500passed
The End of the Welfare StateJuly 2500July 2500defeated
On Child LabourJuly 2500July 2500passed
Quest Encouraging Earnest Re-assesment Steps (Q.U.E.E.R.S)May 2500May 2500defeated

Random fact: In cases where a party has no seat, the default presumption should be that the party is able to contribute to debates in the legislature due to one of its members winning a seat at a by-election. However, players may collectively improvise arrangements of their own to provide a satisfying explanation for how parties with no seats in the legislature can speak and vote there.

Random quote: "We never know the worth of water 'til the well is dry." - Thomas Fuller

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 54