Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: August 5575
Next month in: 00:01:55
Server time: 15:58:04, November 28, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Reichspartei[?]

This page contains information about the Reichspartei.

This party is inactive.

Details

User[?]: fook

Nation[?]: Mikuni-Hulstria (Hulstria and Gao-Soto)

Seats[?] in Parlament/Gikai[?]: 0

Color[?]:

 

Description[?]:

A new party fully committed to progressive socialism.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristexcellentperfect
Civil Rightsmoderate restrictivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaningmoderateperfect
Government Responsibilitiesconvinced big governmenthighperfect
Marketfanatical regulatorexcellentperfect
Militaryconvinced militaristmoderateperfect
Moralitymoderate progressivehighperfect
Religionmoderate secularhighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
February 249713,696,60397,688,15214.02+14.027150014.20+71
February 25006,971,394100,881,8236.91-7.11355007.00-36
December 25018,694,177102,667,6618.47+1.56445008.80+9
December 25023,200,285100,904,7703.17-5.30155003.00-29

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Reichspartei.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496

BillCreatedVoting startedVoteBill StatusResult
State Space ExplorationOctober 2592October 2592defeated
Curfew Policy Act of 2592October 2592October 2592passed
Police Department ActOctober 2592October 2592passed
Individual Freedom bill of 2592July 2592January 2593defeated
IRP Proposal: MuseumsNovember 2591October 2592defeated
Fire Department ActMay 2591May 2591passed
General Reforms on Government PolicyOctober 2590October 2590passed
Crownland Parks Act 2591June 2590April 2591defeated
Space Exploration (Privatisation) Act 2591June 2590April 2591passed
National Education Act 2591June 2590April 2591defeated
Food Vendors (Abolition of Licensing) Act 2591June 2590April 2591passed
Telecommunications (Privatisation) Act 2591May 2590April 2591passed
Energy (Privatisation) Act 2591May 2590April 2591defeated
Crossdressing BanApril 2590April 2590defeated
Central Government Act of 2590April 2590April 2590defeated
Religious MattersApril 2590April 2590passed
Eminent Domain ActApril 2590April 2590defeated
Power to the Police ForceApril 2590April 2590defeated
IRP Proposal: Farm Productivity and the GovernmentNovember 2589April 2590defeated
HNP General Treatise on GovernmentMay 2589June 2589passed

Random fact: Moderation will not accept Cultural Protocol updates which introduce, on a significant scale, cultures which are likely to be insufficiently accessible to players. In particular, for all significant cultures in Particracy, it should be easy for players to access and use online resources to assist with language translation and the generation of character names. Moderation reserves the right to amend Cultural Protocols which are deemed to have introduced significant cultures that are not sufficiently accessible and which are not being actively role-played with.

Random quote: "A fanatic is one who can't change his mind and won't change the subject." - Winston Churchill

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51