Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: November 5475
Next month in: 01:56:08
Server time: 10:03:51, April 27, 2024 CET
Currently online (1): JWDL | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Endralon Progress Party[?]

This page contains information about the Endralon Progress Party.

This party is inactive.

Details

User[?]: Nachume Souseki

Nation[?]: Harmadik Ndráloni Direktoriális Köztársaság (Endralon)

Seats[?] in Legislative Senate[?]: 0

Color[?]:

 

Description[?]:

The Endralon Progress Party(EPP) is a political party leaded by Dr.Nachume Souseki PhD in law. The main objectives of the EPP is to achieve social and political stablility in the Republic of Endralon and raise the living standards for all. Endralon Progress Party focuses mainly on the economic development of the nation and is determined to obtain a highly transparent government and military

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsconvinced permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalistlimitedperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketregulator-leaninghighperfect
Militarymoderate militaristlimitedperfect
Moralityconvinced progressivelimitedperfect
Religionmoderate secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
May 2758124,753216,961,0370.06+0.0607500.00+0
March 2760114,839126,786,0590.09+0.0307500.00+0
September 276256,273,382177,691,62631.67+31.589630032.00+96
March 276556,221,087172,284,03032.63+0.9610030033.33+4
September 276756,083,615173,203,56932.38-0.259930033.00-1
March 277053,813,481167,760,66132.08-0.309830032.67-1
September 277257,914,742171,003,57433.87+1.7910330034.33+5
March 277554,027,846169,800,89831.82-2.059930033.00-4
September 277766,404,174192,305,23634.53+2.7110530035.00+6
March 278075,155,313192,828,19638.98+4.4411830039.33+13
September 278273,205,633192,275,86338.07-0.9011530038.33-3
March 278550,834,523197,057,21825.80-12.288130027.00-34
September 278722,768,388207,650,40810.96-14.833230010.67-49
March 27904,847,928204,089,2772.38-8.5973002.33-25
September 2792133,573208,936,4030.06-2.3103000.00-7
March 2795134,707236,559,0760.06-0.0103000.00+0
March 323045,57955,970,6670.08+0.0202700.00+0
March 323310,349,82458,377,61617.73+17.654827017.78+48
March 32367,806,86859,462,66713.13-4.603727013.70-11
March 32399,342,91959,548,07215.69+2.564327015.93+6
March 32429,467,92664,090,77614.77-0.924027014.81-3
March 32457,491,17760,874,60512.31-2.473327012.22-7
March 32485,150,00664,023,6278.04-4.26212707.78-12

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Endralon Progress Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505

BillCreatedVoting startedVoteBill StatusResult
immigrationNovember 2109November 2109passed
Local Bomb SheltersOctober 2109October 2109defeated
Constitutional Reform Act 2108September 2109September 2109defeated
drug policyJune 2109June 2109passed
Pharmaceutical drugs policyJune 2109June 2109passed
Research and Development in Prescription DrugsDecember 2108December 2108passed
banning guns againOctober 2108October 2108defeated
Cabinet Proposal of October 2108October 2108October 2108passed
Prefectures in the Buff!October 2108October 2108defeated
School Discipline Act 2108September 2108September 2108defeated
Recreational Drug Policy Reform 2108September 2108September 2108defeated
Situationist Bill 2108 (Nationality Reform)September 2108September 2108passed
Situationist Bill 2108 (Nomenclature Reform)September 2108September 2108defeated
Situationist Bill 2108 (Defense Industry Privatization)September 2108September 2108passed
Eminent Domain Act 2108August 2108August 2108defeated
Pension Act 2108August 2108August 2108defeated
Reproductive Rights Act 2108August 2108August 2108defeated
Environment and the taxpayerDecember 2107December 2107defeated
Government size adjustmentDecember 2107December 2107defeated
International aidDecember 2107December 2107defeated

Random fact: All role-play must respect the established cultural background in Culturally Protected nations.

Random quote: "You can't give the government the power to do good without also giving it the power to do bad, in fact, to do anything it wants." - Harry Browne

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51