Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: July 5488
Next month in: 01:04:07
Server time: 18:55:52, May 24, 2024 CET
Currently online (1): Libertarianie | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Truth Party[?]

This page contains information about the Truth Party.

This party is inactive.

Details

User[?]: Cruisey

Nation[?]: Dolgavas Impērija / Dolgavan Empire (Dolgava)

Seats[?] in Dolgavas impērijas parlaments (Imperial Dolgavan Parliament)[?]: 0

Color[?]:

 

Description[?]:

Traditionally the doctrine of separation of powers has prevented those who know the law from taking part in its creation. Because of this, career politicians who know nothing have taken control of the legislative process, passing inane laws and expecting the Courts to apply them.
The Truth Party seeks to change this. It is made up of former members of the Judiciary who want to see this nation have a sensible system of laws.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsrestrictive-leaninglimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiesmoderate small governmentlimitedperfect
Marketregulator-leaninglimitedperfect
Militarypacifist-leaninglimitedperfect
Moralityconservative-leaninglimitedperfect
Religionmoderate secularlimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
June 250452,24699,978,5810.05+0.0505550.00+0
December 25069,934,222100,203,9109.91+9.86555559.91+55
June 250919,020,423101,608,75918.72+8.8110555518.92+50
December 251110,738,334102,902,46010.44-8.285755510.27-48
June 251410,688,08897,630,30710.95+0.516055510.81+3
December 251614,478,762100,306,05414.43+3.498055514.41+20
June 251910,113,169100,644,70010.05-4.395655510.09-24
December 25218,300,761101,322,0298.19-1.86455558.11-11
June 25246,779,180101,760,9166.66-1.53375556.67-8
December 25267,357,460107,942,2036.82+0.15365556.49-1
June 25297,224,141108,438,0226.66-0.15355556.31-1
December 25313,888,619107,734,5003.61-3.05185553.24-17
June 25345,938,895107,467,4335.53+1.92295555.23+11

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Truth Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394

BillCreatedVoting startedVoteBill StatusResult
Eminent Domain (Repeal) ActFebruary 2478February 2478passed
National Energy Generation ActFebruary 2478February 2478passed
National Housing ActFebruary 2478February 2478passed
Railways (Privatization) ActFebruary 2478February 2478passed
LawDecember 2477December 2477passed
Freedom of SexFebruary 2477February 2477defeated
Dolgarian Empire Revival IXFebruary 2477February 2477defeated
Call for early elections, June 2476June 2476April 2477defeated
Federal ReformFebruary 2476February 2476defeated
Money BillFebruary 2476February 2476defeated
National Electricity ActMarch 2475March 2475passed
National Postal Services ActMarch 2475March 2475passed
Elephant poloJanuary 2475January 2475defeated
Cabinet Proposal of September 2474September 2474September 2474passed
WeaponsSeptember 2474September 2474defeated
PatriotismAugust 2474August 2474defeated
Anti-socialismAugust 2474August 2474defeated
National Housing ActSeptember 2473September 2473defeated
TOCJuly 2473July 2473passed
Say NO to Homelessness IIJuly 2473July 2473passed

Random fact: The people in your nation don't like inactive parties. When you often abstain from voting for a bill, they will dislike your party and your visibility to the electorate will decrease significantly. Low visibility will means you are likely to lose seats. So keep in mind: voting Yes or No is always better than Abstaining.

Random quote: "Fascism is a religion. The twentieth century will be known in history as the century of fascism." - Benito Mussolini

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 52