Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: January 5493
Next month in: 01:44:24
Server time: 18:15:35, June 02, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Tavisupali Hobratsi[?]

This page contains information about the Tavisupali Hobratsi.

This party is inactive.

Details

User[?]: liegeborough

Nation[?]: Hobratsuri Respublika (Hobrazia)

Seats[?] in Erovnuli Asamblea (National Assembly) [?]: 0

Color[?]:

 

Description[?]:

Tavisupali Hobratsi (Free Hobrazia) is a conservative liberal party in favour of strengthening the institutions of private property and property rights, privacy, and personal initiative to promote healthy competition.

It seeks to restore the Hobrazian Monarchy, overturn the communist reforms pervading Hobrazian society, and restore political authority and stability.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsrestrictive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalistmoderateperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketregulator-leaningmoderateperfect
Militaryconvinced militaristhighperfect
Moralityconservative-leaningmoderateperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
July 395518,144,35555,469,29432.71+32.7115949532.12+159
July 39589,378,55665,436,38014.33-18.387150014.20-88
July 39618,837,28965,074,81313.58-0.756650013.20-5
July 39645,672,50860,096,4139.44-4.14475009.40-19
July 396716,961,15153,716,31631.58+22.1415950031.80+112

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Tavisupali Hobratsi.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347

BillCreatedVoting startedVoteBill StatusResult
Bill concerning granting nationality (2nd try)March 2182September 2182defeated
Retirement Act (2181)September 2181March 2183defeated
Morality Act (2181)September 2181December 2182defeated
Religion Act (2181)September 2181September 2182passed
changing eminent domain routines.June 2181September 2182passed
Introducing Hobrazian Forest Management InstituteJune 2181September 2182passed
Embassy legalityJune 2181September 2182passed
Ratification of the TOA (Terran Olympic Association)June 2181September 2182passed
End Property Theft Act.December 2180January 2181defeated
Military Reform Act (2180)March 2180September 2183defeated
Animal Registration Act (2180)March 2180September 2181defeated
Socialist Welfare Reform (2180)March 2180September 2181defeated
Welfare Update of -2179-December 2179December 2180defeated
Private Housing Act -2179-October 2179December 2179defeated
Legal Aid to the AccusedJuly 2179July 2185defeated
National AnthemJuly 2179June 2180defeated
Foreign Investment RegulationJuly 2179June 2180defeated
Art CopyrightJuly 2179January 2180defeated
Private Grid Act.July 2179October 2179passed
Strike Reform of 2179July 2179October 2179defeated

Random fact: The majority of nations in Particracy are "Culturally Protected" with an established cultural background. Only the "Culturally Open" nations are not bound by the rules surrounding culture. The Cultural Protocols Index should be consulted for more information about the cultural situation of each nation.

Random quote: "Nature provides a free lunch, but only if we control our appetites." - William Ruckelshaus

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 53