Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: December 5475
Next month in: 02:40:04
Server time: 13:19:55, April 27, 2024 CET
Currently online (2): burgerboys | JourneyJak | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Narik Nationalestik Parti[?]

This page contains information about the Narik Nationalestik Parti.

This party is inactive.

Details

User[?]: rojjo

Nation[?]: Doppelrepublik Narikenland und Darnussien / Dubbele republiek Narikenland en Darnoessiƫ (Narikaton and Darnussia)

Seats[?] in Nationalrat (National Council)[?]: 0

Color[?]:

 

Description[?]:

Founded in 2805 (as the Socialist Worker Party), by John Adams. Two Darnussian parties merged, the Socialist Worker Party and the Radical Democrats, which resulted in the creation of the Narik Nationalestik Parti.

NOTE: FORMER PARTY!

Wiki page;

http://particracy.wikia.com/wiki/Narik_Nationalestik_Parti

(Illegal) Paramilitary Organization affiliated with the NNP: Narikton Separatist Army

Former names;

Socialist Worker Party 2805 - 2838
Roy Versteeg List 2838 - 2868
Darnussian Populist Movement 2868 - 3008
Democratic Party of Darnussia 3008 - 3017

Internal factions:

New Narik Nationalists (Largest Faction); Narik Nationalist, Social centrists and Fiscal liberals, extreme-authoritarian.
Traditional Narik Nationalists (Very Important Faction); Right-wing, Narik Nationalist, Supporters of Mastertoni and Deimore.
Liberal Democrats and Social Liberals (Smallest faction); Centrist, liberal, progressive.
Religious Democrats; Centrist, moderate, oppose abortion and eutanasia.
Social Democrats; Left-wing; progressive, big-government.

Motto:

'Let's fight for our own country!'

Ideology; New Narik Nationalism, Centrism, Liberalism

Political Positions;

Fiscal; Right-wing
Social; Centrist

Vote Narik Nationalestik Parti for an independent Narikaton!

NNP Policies;

Abortion - Oppose
Capital Punishment - Oppose
Economics - Free Market Economy, protectionism
Education - Support private education
Euthanasia Rights - Oppose
Gun Control - Private Sale of Firearms should be legal
Healthcare - Private healthcare is the key to good healthcare
Immigration - Stricter Immigration policies are good for our nation. Close the borders!
LGBT Rights - Supports equal rights for LGBT people, but marriage is for man and woman only, it's not all about marriage
Taxes - Flat taxes are appropriate
Religion - Secularism is important, religion is personal
Military - We support agressive military stances and a strong defence industry

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningexcellentperfect
Civil Rightsrestrictive-leaningexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiesmoderate small governmentexcellentperfect
Marketlaissez-faire-leaningexcellentperfect
Militarymoderate militaristexcellentperfect
Moralityconservative-leaningexcellentperfect
Religionsecular-leaningexcellentperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
April 2806166,411252,220,7640.07+0.0702000.00+0
January 2809181,479258,550,5650.07+0.0002000.00+0
January 28132,845,986257,360,6771.11+1.0422001.00+2
January 281753,026,115256,538,53620.67+19.564020020.00+38
January 282139,616,923244,442,90716.21-4.463320016.50-7
January 282547,277,130268,241,35717.62+1.423320016.50+0
January 282943,386,260268,435,12516.16-1.463220016.00-1
January 283345,108,758268,049,51816.83+0.673320016.50+1
January 283748,620,864271,178,21517.93+1.103620018.00+3
January 284148,080,288249,660,64519.26+1.333720018.50+1
January 284538,386,398232,177,87316.53-2.733120015.50-6
January 284948,615,278216,261,11422.48+5.954520022.50+14
January 285397,094,826246,102,04239.45+16.978120040.50+36
July 285638,490,388261,294,96714.73-24.723222514.22-49
January 286047,698,255272,664,20717.49+2.764022517.78+8
July 286339,638,510274,265,63514.45-3.043122513.78-9
January 2867111,892,426244,976,03845.67+31.2210922548.44+78
July 287056,704,540269,501,52721.04-24.634822521.33-61
January 287464,224,212257,080,70424.98+3.945722525.33+9
July 287775,965,529310,437,97524.47-0.515622524.89-1
January 288171,537,739295,610,94624.20-0.275522524.44-1
July 288451,108,635307,794,32516.60-7.603722516.44-18
January 288856,939,757293,085,42719.43+2.824121019.52+4
July 289168,030,312303,294,81522.43+3.004821022.86+7
January 289561,609,849305,614,65120.16-2.274221020.00-6
July 289855,218,603284,711,24819.39-0.764121019.52-1
January 290264,542,303307,910,66020.96+1.574421020.95+3
July 290570,759,032295,876,85123.92+2.954921023.33+5
January 290983,240,681336,743,20824.72+0.805121024.29+2
July 291279,850,182343,746,12123.23-1.494821022.86-3
January 291698,653,612362,999,74727.18+3.955621026.67+8
November 291694,375,034360,639,44726.17-1.015521026.19-1
May 292087,375,440364,004,99024.00-2.164821022.86-7
November 292353,350,305361,494,31714.76-9.253121014.76-17
May 292753,225,033364,077,86014.62-0.143021014.29-1
November 293049,051,725366,110,42713.40-1.222721012.86-3
February 293149,735,760366,163,80213.58+0.182921013.81+2
August 293434,959,526372,121,6929.39-4.19202159.30-9
February 293873,381,857370,570,98319.80+10.414121519.07+21
August 294148,463,909371,618,00213.04-6.762821513.02-13
February 294549,889,277380,066,95613.13+0.092821513.02+0
August 294855,227,172389,496,23814.18+1.053021513.95+2
February 295247,428,962393,223,86312.06-2.122521511.63-5
August 295550,536,703388,512,84013.01+0.952621512.09+1
February 295943,820,307389,432,86911.25-1.762321510.70-3
January 296169,583,654359,809,70719.34+8.094021518.60+17
July 296437,166,258366,243,40510.15-9.19151758.57-25
July 296641,169,677345,732,87211.91+1.761917510.86+4
January 297068,617,193378,218,15018.14+6.233117517.71+12
July 297371,729,659388,143,92018.48+0.343217518.29+1
January 297769,302,683392,511,64817.66-0.823117517.71-1
July 298069,757,244391,331,60117.83+0.173017517.14-1
January 298471,454,476383,792,17018.62+0.793217518.29+2
July 298774,682,361384,437,71719.43+0.813217518.29+0
January 299173,040,078401,528,39618.19-1.243017517.14-2
March 299388,541,064451,295,83519.62+1.433517520.00+5
September 299630,981,726437,707,0697.08-12.54111756.29-24
December 299738,329,350410,541,4789.34+2.26151758.57+4
June 300123,626,861435,876,1975.42-3.9271754.00-8
December 300425,172,834428,969,5485.87+0.4581754.57+1
June 300836,401,377460,863,0667.90+2.03121756.86+4
June 301048,494,978439,491,40311.03+3.141917510.86+7
December 301350,569,204433,725,70711.66+0.621817510.29-1
June 301754,406,893438,913,72412.40+0.742117512.00+3

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Narik Nationalestik Parti.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515

BillCreatedVoting startedVoteBill StatusResult
Stop the Murders ActNovember 2152November 2152defeated
Space TravelSeptember 2152September 2152defeated
Charter SchoolsJune 2152June 2152defeated
Treaty WithdrawalJune 2152June 2152defeated
Prison LaborJune 2152June 2152defeated
Hiring PoliciesJune 2152June 2152defeated
The "I'm Not 'Regulator-Leaning', Dammit!" ActJune 2152June 2152passed
Tort ReformJune 2152June 2152passed
Nuclear Weapon UsageJune 2152June 2152passed
Free Marriage ActJune 2152June 2152defeated
Strategic Crops Production ActJune 2152June 2152defeated
Commercial Use of the National Flag ActJune 2152June 2152defeated
Eminent Domain ActJune 2152June 2152defeated
Limited Televised Sexual Content ActJune 2152June 2152passed
Foreign Missionary Registration ActJune 2152June 2152defeated
Free Access to Phone Service BillJune 2152June 2152defeated
Tobacco Regulation ActJune 2152June 2152defeated
Licensed Food VendorsJune 2152June 2152defeated
Voluntary Government-Issued Identity CardsJune 2152June 2152passed
Modification to Cabinet ProposalsJune 2152June 2152defeated

Random fact: Moderation will not implement nation renaming requests where the proposed name does not comply with the requirements set out in the Nation Renaming Guide: http://forum.particracy.net/viewtopic.php?f=11&t=6364

Random quote: "A people that values its privileges above its principles soon loses both." - Dwight D. Eisenhower

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 52