Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: April 5480
Next month in: 01:11:04
Server time: 06:48:55, May 08, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Hobrazian Socialist Party[?]

This page contains information about the Hobrazian Socialist Party.

This party is inactive.

Details

User[?]: Chi

Nation[?]: Hobratsuri Respublika (Hobrazia)

Seats[?] in Erovnuli Asamblea (National Assembly) [?]: 0

Color[?]:

 

Description[?]:

The Liberal Democratic Socialist party is a socialist idealed party which is based on the principles of equality and democracy. We seek to bring more equality to the classes and we favour decentralisation of the goverment, seek proguessive constitutional reform and wish to improve international relations.

We believe in equality between every race, creed and sex.
We believe and promote democracy. We are also interested in looking after the enviroment of Terra. A balance of internationalism and isolationism is neccessary to stop the capitalist disease. Long Live Hobrazia! Long Live CSALDSP.
Long Live Zargundia!

We are against intolerance for equality especially racism and anti-democracy views.

Important members:
Leader of the Party: Joseph Delaney, age:39
Emma Tripe (minister for enviroment and tourism), age:27
Giles Hamilton (the influential two time running minister for food and agriculture), age:53
Charles Dittany (minister for science and technology and founder of the Hobrazian Darwin Institute), age:60
Margaret Grush (minister for Health and social services), age : 43
Alan pennyworth (Challenging Joseph Delaney for leadership of the party and candidate for finance).

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristlimitedperfect
Civil Rightsrestrictive-leaninglimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiesmoderate big governmentmoderateperfect
Marketmoderate regulatormoderateperfect
Militaryconvinced militaristclose to noneperfect
Moralityunknownclose to noneperfect
Religionsecular-leaningclose to noneperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
September 24471,383,13378,041,1251.77+1.7764001.50+6
September 24503,340,82874,062,8444.51+2.74174004.25+11
September 24533,556,23079,371,5274.48-0.03184004.50+1
September 24566,922,01075,907,8529.12+4.64344008.50+16
September 24597,058,58280,051,6828.82-0.30344008.50+0
September 246211,025,17984,805,06313.00+4.185140012.75+17
September 24654,829,95382,238,1775.87-7.13224005.50-29
September 24684,365,91982,091,9665.32-0.55204005.00-2
February 24712,569,98680,470,1653.19-2.12114002.75-9
February 24744,306,04286,391,5394.98+1.79194004.75+8
February 24773,485,12684,064,3304.15-0.84164004.00-3

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Hobrazian Socialist Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346

BillCreatedVoting startedVoteBill StatusResult
Luthori Crisis ActDecember 2172May 2174passed
Eminent Domain is Ok, As Long As It's Not My House- Repeal Act -2172.December 2172March 2173defeated
Government Housing Act (2172)October 2172February 2173defeated
Ratification of the Democratic Governance TreatySeptember 2172November 2172passed
Smoking Bill. -(Take 3)-September 2172November 2172defeated
New Day For Power Travel (Freedom Act).September 2172November 2172defeated
Right To Choose a Pension Act -2172-August 2172September 2172defeated
Adoption Act (2172)July 2172October 2172passed
Reintroduction of the Hobrazian Arms AuthorityJuly 2172August 2172defeated
Organ Donation Act (2172)July 2172July 2172defeated
Industry Emergency Act, y otra vezJuly 2172July 2172passed
Compromising car policyJune 2172April 2173passed
Firefighters Are Not The Central Government's to Control Act.March 2172August 2172defeated
Public Housing InitiativeMarch 2172June 2172passed
Agricultural subsidising BillFebruary 2172April 2173passed
Trade protection act.February 2172April 2173defeated
Supporting new top athletes (2nd try)February 2172April 2173passed
Introducing National Food Control (2nd try)February 2172April 2173defeated
Energy reform billFebruary 2172February 2173defeated
Ratification of the Barmenistan Free Trade AgreementFebruary 2172August 2172defeated

Random fact: Particracy has 464 player slots.

Random quote: "Any law which violates the inalienable rights of man is essentially unjust and tyrannical; it is not a law at all." - Maximilien Robespierre

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51