Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: June 5497
Next month in: 01:05:01
Server time: 14:54:58, June 11, 2024 CET
Currently online (2): AethanEge | Montersis | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Kazulian Nasjonal Allianse[?]

This page contains information about the Kazulian Nasjonal Allianse.

This party is inactive.

Details

User[?]: malkaz

Nation[?]: Kongeriket av Kazulmark (Kazulia)

Seats[?] in Storting[?]: 0

Color[?]:

 

Description[?]:

Founded May 28th, 3170.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristmoderateperfect
Civil Rightsrestrictive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiesmoderate big governmentmoderateperfect
Marketconvinced regulatormoderateperfect
Militarymoderate militaristlimitedperfect
Moralityconservative-leaningmoderateperfect
Religionconvinced secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
April 31722,038,87935,980,2865.67+5.67283009.33+28
April 31775,202,91529,817,28817.45+11.785330017.67+25
April 31826,051,58626,649,55422.71+5.266830022.67+15
April 318710,158,35214,250,46971.28+48.5823930079.67+171
August 318811,827,89211,827,892100.00+28.727575100.00-164
August 319411,860,45911,860,459100.00+0.007575100.00+0
August 32005,596,30212,025,64246.54-53.46367548.00-39
August 32063,717,45112,141,42530.62-15.92237530.67-13
February 32106,400,29227,216,36523.52-7.10197525.33-4
February 32126,743,69829,477,12622.88-0.6411246024.35+93
February 32148,263,88930,692,00526.93+4.0513146028.48+19
February 32168,975,08131,693,40128.32+1.3913946030.22+8
February 321813,619,46438,406,65435.46+7.1416446035.65+25
February 322011,255,26750,097,12722.47-12.9910146021.96-63
January 32226,743,64335,969,07418.75-3.7213773518.64+36
January 32244,447,94025,552,41017.41-1.3412973517.55-8
January 32268,934,44041,821,40021.36+3.9615773521.36+28
January 32289,317,20237,128,00225.09+3.7317773524.08+20
January 322914,002,50554,367,56525.76+0.6618673525.31+9
January 32319,012,27557,896,68415.57-10.1911373515.37-73
January 323319,441,71763,660,95330.54+14.9722573530.61+112
January 323515,291,44060,486,27825.28-5.2618573525.17-40
January 323716,649,14058,793,11228.32+3.0420773528.16+22
January 323915,754,28664,434,41324.45-3.8718173524.63-26
December 324017,266,05859,193,24329.17+4.7221373528.98+32
December 324215,940,95760,197,43526.48-2.6919373526.26-20
July 324415,686,67955,079,73928.48+2.0020973528.44+16
July 324614,386,71153,528,59126.88-1.6019873526.94-11
July 324813,264,42850,060,05426.50-0.3819573526.53-3
July 325013,311,44350,025,98426.61+0.1119573526.53+0
July 325213,348,08249,423,57327.01+0.4019873526.94+3
July 325413,208,98148,810,19727.06+0.0519973527.07+1
July 325612,188,02747,919,76225.43-1.6318773525.44-12
January 325818,913,88740,515,55846.68+21.2534573546.94+158
January 326017,938,09039,616,27645.28-1.4033373545.31-12
January 326218,331,73539,415,04446.51+1.2334373546.67+10
January 3264704,06360,111,9611.17-45.3477350.95-336
January 326656,28945,421,9100.12-1.0507350.00-7
January 326841,36846,160,5150.09-0.0307350.00+0
January 327048,83347,136,0770.10+0.0107350.00+0
January 327240,67749,151,3210.08-0.0207350.00+0
January 327442,99350,389,8460.09+0.0007350.00+0
January 327618,28250,087,3020.04-0.0507350.00+0
January 327828,50556,959,1660.05+0.0107350.00+0
January 328012,837,50853,166,53324.15+24.1017573523.81+175
January 328224,476,70350,031,98248.92+24.7835573548.30+180
January 328423,598,79150,503,81546.73-2.2033673545.71-19
January 328624,045,71149,985,63948.11+1.3834773547.21+11
January 328823,052,83148,060,32347.97-0.1434873547.35+1
January 329422,904,15538,887,39758.90+10.9329249958.52-56
June 329511,833,77811,833,778100.00+41.10499499100.00+207
December 329655,752,71655,774,09699.96-0.047575100.00-424
August 329913,391,62648,328,03027.71-72.25207526.67-55
December 32995,387,41832,438,55916.61-11.10147518.67-6
December 33055,275,77927,302,54219.32+2.72167521.33+2
December 331125,632,94354,626,24646.92+27.60357546.67+19
January 331320,913,49946,553,20544.92-2.00347545.33-1
August 331419,846,11845,624,46143.50-1.43357546.67+1
August 331622,767,58453,873,92942.26-1.24347545.33-1
August 331819,240,64953,293,09536.10-6.16277536.00-7
October 331919,989,29353,983,28137.03+0.93287537.33+1
October 332319,031,73551,685,26136.82-0.214713135.88+19
October 332718,097,51651,186,72635.36-1.474613135.11-1
December 332911,376,69511,376,695100.00+64.64131131100.00+85
December 333311,741,69911,741,699100.00+0.00131131100.00+0

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Kazulian Nasjonal Allianse.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471

BillCreatedVoting startedVoteBill StatusResult
Reformed Welfare ActApril 3890October 3890passed
Motion of ConfidenceJanuary 3890January 3890defeated
SD Minority GovernmentNovember 3889November 3889passed
Constitution (Head of State) Amendment ActJanuary 3889January 3889defeated
Postal Services ActMay 3888May 3888passed
Inheritance ActMay 3888May 3888passed
Animal Welfare ActMay 3888May 3888passed
Forestry ActMay 3888May 3888passed
Software ActMay 3888May 3888passed
Democratic Ownership ActMay 3888May 3888passed
Campaign Finance ActMay 3888May 3888passed
Military Enhancement Act, 3888February 3888October 3888defeated
Trade Reform Act, 3888February 3888October 3888defeated
Ratification of the International Civil Aviation Organization (ICAO)July 3887July 3887passed
Education Diversity Act, 3887March 3887March 3887defeated
Subsidy Review Act, 3887March 3887March 3887defeated
Eminent Domain Abolition Act, 3887March 3887March 3887defeated
Revenue and Appropriations Act (I)December 3886December 3886passed
Revenue and Appropriations Act (II)December 3886December 3886passed
Entrepreneurial Spirit Encouragement Act, 3886October 3886October 3886defeated

Random fact: "Nation raiding" or a malevolent coordinated effort by a single user or group of users to interrupt the gameplay, significantly alter the culture or direction of a nation is strictly prohibited. Players interacting in nation raiding will be sanctioned.

Random quote: "If we don't believe in freedom of expression for people we despise, we don't believe in it at all." - Noam Chomsky

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51