Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5573
Next month in: 01:34:14
Server time: 22:25:45, November 24, 2024 CET
Currently online (1): Jacob Noakes | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


FIBB Party[?]

This page contains information about the FIBB Party.

This party is inactive.

Details

User[?]: isuquinndog

Nation[?]: Mikuni-Hulstria (Hulstria and Gao-Soto)

Seats[?] in Parlament/Gikai[?]: 0

Color[?]:

 

Description[?]:

For the betterment of individuals every where.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightsrestrictive-leaningexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiessmall government-leaningexcellentperfect
Marketconvinced regulatorexcellentperfect
Militarymoderate militaristmoderateperfect
Moralityconservative-leaningexcellentperfect
Religionsecular-leaningexcellentperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
December 255170,409124,898,5860.06+0.0605000.00+0
June 25543,859,692120,267,0533.21+3.15155003.00+15
December 255610,614,592117,852,1229.01+5.80435008.60+28
June 25593,832,772117,259,2503.27-5.74145002.80-29

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the FIBB Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496

BillCreatedVoting startedVoteBill StatusResult
Religious Education Act 3450March 3450March 3450defeated
Electoral Reform Act of 3450January 3450July 3450passed
Banning coerced prayer ActJuly 3449December 3449defeated
And end to unrestrained 'Intelligence' OperationsJuly 3449December 3449passed
The Proper, Polite and God-Fearing BillJune 3449June 3449defeated
OOC: Renaming our News ThreadMarch 3449October 3450passed
Emergency Services Act 3449March 3449September 3449passed
Transportation Act 3449March 3449September 3449passed
Political and Parliamentary RPing ProtocolsDecember 3448December 3791defeated
Resolution regarding the remembrance of Thomas Michels and Okatori Kurosawa, 3448December 3448February 3449passed
Nobility (Life and Historical Peerages) Bill, 3448December 3448February 3449passed
Abortion (Financial Support) Bill, 3448December 3448January 3449passed
Devolution of Education to the LantagsDecember 3448December 3448defeated
Private Members' Business: Bill of Values, 3448December 3448December 3448defeated
Freedom of Arms BillJuly 3448August 3448defeated
An End to 'Eminent Domain'July 3448August 3448passed
Education Act 3448May 3448July 3448passed
The Proper and Polite Family Values BillDecember 3447December 3447defeated
The Proper and Polite Education BillDecember 3447December 3447defeated
Death of Mikado Okatori Kurosawa and accession of Mikado Okatori Kanjiro (and associated title changes)October 3447October 3447passed

Random fact: Don't vote yes on a cabinet coalition that doesn't give you the power that you deserve.

Random quote: "Public schools are government-established, politician- and bureaucrat-controlled, fully politicized, taxpayer-supported, authoritarian socialist institutions. In fact, the public-school system is one of the purest examples of socialism existing in America." - Thomas L. Johnson

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51