Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: May 5497
Next month in: 02:10:37
Server time: 09:49:22, June 11, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Progressive Party[?]

This page contains information about the Progressive Party.

This party is inactive.

Details

User[?]: ejismyhomie

Nation[?]: Dai Sekouokoku (Seko)

Seats[?] in 国会 - Kokkai (Imperial Diet) [?]: 0

Color[?]:

 

Description[?]:

Party Founder: Ivan Gonzales
Party Leaders: Ivan Gonzales(since est.-2343)
Presidente Alfonso Gonzales(2343-2355)
Presidente Roberta Garcia(2355-present)

___________________________________
Party Motto:
"Fatherland! Socialism! Freedom! Democracy!"
-Ivan Gonzales
from his book "Our Destiny"

___________________________________
Platform of the Progressive Party:

-The Party believes that democracy should be used not only in governing, but also in the workplace.

-The Party believes that our military forces should only be used if we are invaded or attacked.

-The Party promotes world peace.

-The Party supports unions, the right to strike, and Democratic Workers' Councils.

-The Party supports the freedom of speech.

-The Party is environmentally progressive and would like to see changes made to help the environment.

_________________________
Mission Statement:
The Progressive Party wishes to make the government's main purpose to benefit the working class with Socialist programs and to allow people to live freely without harming the freedom of other people.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationfederalist-leaninglimitedperfect
Civil Rightsmoderate permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaningmoderateperfect
Government Responsibilitiesmoderate big governmentmoderateperfect
Marketconvinced regulatormoderateperfect
Militaryconvinced pacifistmoderateperfect
Moralitymoderate progressivemoderateperfect
Religionconvinced secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
October 234047,83051,932,4160.09+0.0902500.00+0
October 234321,146,89748,403,44643.69+43.6011025044.00+110
October 234615,219,06653,114,98828.65-15.047325029.20-37
October 234916,846,96955,453,37930.38+1.737525030.00+2
October 235218,182,60254,881,63933.13+2.758425033.60+9
October 235518,946,18653,327,31335.53+2.409025036.00+6
October 235819,310,51058,696,64532.90-2.638225032.80-8
October 236030,367,17155,494,54254.72+21.8227550055.00+193
October 236218,559,31133,706,02055.06+0.3427350054.60-2
October 236419,949,09334,736,07157.43+2.3728550057.00+12
October 236636,779,96355,967,86965.72+8.2932750065.40+42
October 236841,146,20757,172,33871.97+6.2535450070.80+27

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Progressive Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374

BillCreatedVoting startedVoteBill StatusResult
PPS- Economic BillDecember 2519December 2519defeated
Peasant Party PlatformJuly 2518July 2518defeated
Eastern Territories Re-organization Act of 2518March 2518July 2524passed
DSP.054.2518February 2518August 2518passed
DSP.053.2518February 2518August 2518defeated
DSP.052.2518 (Fair Free Trade)February 2518August 2518passed
DSP.051.2518 (Eminent Domain Reform)February 2518August 2518passed
DSP.050.2518 (Social Welfare Reform)February 2518August 2518defeated
Call for early elections, January 2518January 2518January 2518passed
Budget proposal of April 2517April 2517April 2517passed
Budget proposal of October 2516October 2516October 2516defeated
Name Change Act of 2520September 2516September 2520passed
DSP.049.2516 (Progressive Health Reform)September 2516September 2516defeated
PUA Anti-Riot BillJuly 2516July 2516defeated
Tenno Empowerment Bill (2516)June 2516June 2516defeated
PUA War Security BillMay 2516May 2516defeated
Call for early elections, February 2516February 2516February 2516passed
FDP 006: PeaceJanuary 2516July 2516defeated
War (2515-2520)November 2515September 2520passed
Tri-decadal Air Force Expansion 2522August 2515July 2522passed

Random fact: Once approved, players should copy Cultural Protocols into a bill in the debate section of their nation page, under the title of "OOC: Cultural Protocols". This bill should include links to the passed Cultural Protocol bill and the Moderation approval.

Random quote: "I never dared to be radical when young. For fear it would make me conservative when old." - Robert Frost

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 53