Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5573
Next month in: 03:30:49
Server time: 16:29:10, November 24, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Liberale Volkspartei[?]

This page contains information about the Liberale Volkspartei.

This party is inactive.

Details

User[?]: Alain Delors II.

Nation[?]: Mikuni-Hulstria (Hulstria and Gao-Soto)

Seats[?] in Parlament/Gikai[?]: 0

Color[?]:

 

Description[?]:

Chairperson:
Christina von Track (4332-present)
formerly:
- Baron Hademar Holzinger (4318-4332)

Deputy chairpersons:
- Robert Matsuyama (4318-)
- Johann Lanzfels (4338-present)
formerly:
- Lukrezia von Gehrfeld (4318-4338)

Secretary-General:
- Elisabeth Weylandt (4338-present)
formerly:
- Jürgen Rappolter (4318-4338)

Klubobmann (Diet floor leader):
- Dietrich Haslhütter (4338-present)
formerly:
- Constantin von Zollham (4321-4338)

Ideology: Classical liberalism
Political position: Centre-right

Internal factions:
- Conservatism
- Libertarianism
- National liberalism
- Social liberalism

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsmoderate permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiesmoderate small governmentmoderateperfect
Marketlaissez-faire-leaningmoderateperfect
Militarypacifist-leaninglimitedperfect
Moralitymoderate progressivelimitedperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
March 356420,719,70158,992,75635.12+35.1222464334.84+224
January 356919,572,01861,843,05231.65-3.4720864332.35-16
January 35745,663,40854,048,97610.48-21.176964310.73-139
October 35748,082,20560,601,40913.34+2.868664313.37+17
October 35793,769,13559,379,1176.35-6.99406436.22-46
October 35845,058,24259,562,4548.49+2.14546438.40+14
October 358910,384,21961,634,05116.85+8.3610764316.64+53
October 35949,759,51462,730,53615.56-1.299964315.40-8
December 359610,882,34365,201,62116.69+1.1310864316.80+9
December 36019,527,57361,516,30315.49-1.2010064315.55-8
March 36068,608,16861,646,76213.96-1.529064314.00-10
July 360617,468,28649,458,36535.32+21.3622864335.46+138
January 361117,224,41755,497,47231.04-4.2820164331.26-27
January 361619,965,41666,025,69630.24-0.8019564330.33-6
January 362117,532,39561,115,96628.69-1.5518764329.08-8
January 362611,435,33850,214,96922.77-5.9114964323.17-38
March 362810,897,62347,463,44222.96+0.1915264323.64+3
March 363313,572,81057,958,95023.42+0.4615164323.48-1
March 363814,436,85352,222,85127.64+4.2318064327.99+29
March 364315,965,87353,405,10429.90+2.2519464330.17+14
November 364315,393,52547,266,25132.57+2.6721264332.97+18
November 364816,538,61361,265,63026.99-5.5717364326.91-39
January 365220,792,45147,554,09343.72+16.7328364344.01+110
January 365721,024,08356,814,35937.00-6.7224064337.33-43
January 366219,322,27558,592,74732.98-4.0321464333.28-26
January 366712,478,95756,644,02122.03-10.9514364322.24-71
March 366811,637,45055,191,54021.09-0.9413864321.46-5
March 367311,845,94165,261,99718.15-2.9311664318.04-22
March 367811,532,96262,051,84818.59+0.4312064318.66+4
March 368310,830,21255,419,16719.54+0.9612864319.91+8
March 36889,946,70053,990,44118.42-1.1212164318.82-7
March 369323,224,82655,407,51041.92+23.4926564341.21+144
March 369824,649,69163,221,46638.99-2.9325464339.50-11
March 370313,208,88858,717,45322.50-16.4914864323.02-106
December 371123,290,34849,935,12446.64+24.1528564344.32+137
December 371624,771,36453,260,80046.51-0.1328764344.63+2
December 372124,257,59051,542,89047.06+0.5530864347.90+21
December 372630,205,91652,200,85257.86+10.8037564358.32+67
October 373636,547,15552,056,78970.21+12.3441664364.70+41
October 374138,089,18562,453,01660.99-9.2238964360.50-27
August 374615,749,38860,104,45926.20-34.7916864326.13-221
August 375115,628,37949,876,80131.33+5.1320264331.42+34
August 375622,430,81048,679,04746.08+14.7528464344.17+82
August 376130,712,73149,501,68562.04+15.9638764360.19+103
August 376625,412,91849,640,90451.19-10.8532864351.01-59
May 43211,469,92540,838,0223.60-47.59236433.58-305
May 43234,431,38228,656,53215.46+11.869464314.62+71
May 43287,370,34358,627,16412.57-2.897964312.29-15
May 433318,334,19962,239,51729.46+16.8918964329.39+110
May 433815,255,91044,231,31134.49+5.0322664335.15+37
September 434114,497,50529,851,45148.57+14.0733064351.32+104
September 434635,947,83339,036,54692.09+43.5256464387.71+234
September 435112,021,47212,021,472100.00+7.91643643100.00+79

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Liberale Volkspartei.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496

BillCreatedVoting startedVoteBill StatusResult
Ratification of the Agreement to Sanction the Grand Duchy of Ostland, 4416September 4416September 4416defeated
testSeptember 4416September 4416passed
Act of Abdication and Accession of Otto IV, 4415February 4415February 4415passed
Ratification of the FIFA World CupFebruary 4415February 4415passed
Ratification of the The International Treaty on the Prohibition of Land Mines (ITPL)February 4415February 4415passed
Eminent Domain Act, 4415February 4415February 4415passed
Manifesto 2September 4412September 4412defeated
testAugust 4412August 4412passed
Shinpoto manifestoMarch 4412March 4412passed
ARCHIVE: Imperial Families of Hulstria and Gao-SotoFebruary 4412January 4899defeated
Staatsgewaltsmonopoliegesetz, 4412 (State Monopoly of Violence Act, 4412)January 4412January 4412passed
Menschenrechtenschützgesetz, 4412 (Human Rights Protection Act, 4412)January 4412January 4412passed
Volksgesundheitsgesetz, 4412 (Public Health Act, 4412)January 4412January 4412passed
Bürgerdienstgesetz, 4412 (Citizen's National Service Act 4412)January 4412January 4412passed
Dritter Privatisierungstranche, 4412January 4412January 4412passed
Purogureshibuzu Medijinrekuto, 4410December 4410January 4411defeated
Bawarutangusurefomu, 4408, 2September 4408September 4408passed
Ami RefomuAugust 4408August 4408defeated
ARCHIVE: RP Laws (new players please read)March 4408January 4899defeated
ARCHIVE: Basic Law of the United Imperial Crownlands of Hulstria and Gao-Soto, 3410/3418March 4408December 4542defeated

Random fact: Periodically, it is a good idea to go through your nation's Treaties and arrange to withdraw from any that are unwanted.

Random quote: "Africa is poor because its investors and its creditors are unspeakably rich" - Naomi Klein

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51