Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: May 5497
Next month in: 01:34:10
Server time: 10:25:49, June 11, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Prosperous Hobrazia[?]

This page contains information about the Prosperous Hobrazia.

This party is inactive.

Details

User[?]: 1234567

Nation[?]: Hobratsuri Respublika (Hobrazia)

Seats[?] in Erovnuli Asamblea (National Assembly) [?]: 0

Color[?]:

 

Description[?]:

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningexcellentperfect
Civil Rightsmoderate permissiveexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninghighperfect
Government Responsibilitiesmoderate small governmenthighperfect
Marketregulator-leaninghighperfect
Militarymoderate militaristmoderateperfect
Moralityconservative-leaningexcellentperfect
Religionmoderate secularhighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
May 318712,484,37012,484,370100.00+100.007575100.00+75
May 319211,719,47011,719,470100.00+0.00235235100.00+160
May 386856,692,16156,719,64899.95-0.05577577100.00+342
May 387211,696,83511,696,835100.00+0.05265265100.00-312
May 387611,042,35211,042,352100.00+0.00265265100.00+0
May 388057,810,81957,828,45899.97-0.03265265100.00+0

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Prosperous Hobrazia.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347

BillCreatedVoting startedVoteBill StatusResult
State Welfare Legislation: Unemployment BenefitMay 2096May 2096passed
Call for early elections, February 2096February 2096February 2096passed
The Inaugural Binman ActApril 2095April 2095passed
Freedom to Protest and Gather Act.June 2094June 2094passed
Legal action taken against Hobrazian MPJune 2094June 2094passed
Aid BillDecember 2093December 2093defeated
Malivian proposalJune 2093June 2093passed
Civil Defence ProposalJune 2093June 2093passed
Positive Discrimination RepealDecember 2092December 2092defeated
Changing of your national animalJuly 2092July 2092defeated
Eminent Domain Compensation Act.June 2092June 2092defeated
L-PU Cabinet Proposal of April 2092April 2092April 2092passed
Chemical and Biological Weapon disarmament TreatyAugust 2091August 2091passed
Medical Malpractice Act.July 2091July 2091passed
School Prayer Update.March 2091March 2091passed
Technological Research ProposalMarch 2091March 2091passed
Rejection of Biological and Chemical ArmsJanuary 2091January 2091passed
Updated Nuclear Weapons ActJanuary 2091January 2091passed
Private Car Bill of 2090October 2090October 2090defeated
Education Act: Article6, University TuitionSeptember 2090September 2090passed

Random fact: The people in your nation don't like inactive parties. When you often abstain from voting for a bill, they will dislike your party and your visibility to the electorate will decrease significantly. Low visibility will means you are likely to lose seats. So keep in mind: voting Yes or No is always better than Abstaining.

Random quote: "An independent is someone who wants to take the politics out of politics." - Adlai Stevenson

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51