Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: April 5479
Next month in: 01:42:05
Server time: 06:17:54, May 06, 2024 CET
Currently online (1): R Drax | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


United Land Movement[?]

This page contains information about the United Land Movement.

This party is inactive.

Details

User[?]: Vicious Rumor

Nation[?]: Dai Sekouokoku (Seko)

Seats[?] in 国会 - Kokkai (Imperial Diet) [?]: 0

Color[?]:

 

Description[?]:

ενωμένοςσεκοωο ξηρά κίνημα (Romanization: enomenos xira kinima) (Translation: United Land Movement)

Takis Metaxas

The ULM is an authoritarian, religious, and leftist party that follows the philosophy of Egilism as defined by Egil Argyros in his work 'Planning The Modern State'.

Structure

*The creation of a highly centralized state
*Widespread nationalism and patriotism
*State before the Individual
*Increased Authority for the head of state
*Suffrage belongs only to those willing to serve their society

Social Programs

*social justice
*universal health care
*generous welfare and subsidies to improve the conditions of the disadvantaged
*subsidized education
*large foreign aid

Industry

*Protection of domestic industry
*Import quotas on foreign goods
*tariffs on imported goods
*subsidies for domestic industry and exporting industry
*Devaluation of Domestic Currency

Society

*Classes: "Citizens" or "Civilians"
*Structured Society (1: Clergy, 2: Soldiers and Leaders, 3: Educators, 4: Skilled Traders, Merchant, 5: unskilled workers)
*The Adoption of Orthox Christianity as the State Religion
*Adoption of Greek as the Sole national language
*Cultural Proliferation


Militarism

*Increased Spending
*Service for Citizenship
*Development of Nuclear and Chemical Stockpiles
*Division into federal and state militaries
*Enforcement of military discipline

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristmoderateperfect
Civil Rightsmoderate restrictivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate isolationistmoderateperfect
Government Responsibilitiesmoderate big governmentclose to noneperfect
Marketconvinced regulatorlimitedperfect
Militarymoderate militaristhighperfect
Moralitymoderate conservativemoderateperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
April 26652,264,250145,830,0021.55+1.5596001.50+9
April 266610,002,700144,599,4606.92+5.36426007.00+33
April 267010,712,182151,879,5767.05+0.14436007.17+1
April 267411,985,389150,774,5127.95+0.90466007.67+3
April 26783,217,924151,509,5772.12-5.83116001.83-35
April 26826,798,219153,334,9954.43+2.31256004.17+14
December 26848,359,198154,340,9635.42+0.98326005.33+7
November 26879,426,720152,462,7606.18+0.77376006.17+5
May 269114,147,070164,367,2598.61+2.42506008.33+13
November 269410,236,474166,422,0646.15-2.46376006.17-13
April 269612,381,911156,043,9147.93+1.78476007.83+10
October 269923,482,573167,344,42014.03+6.108460014.00+37
April 270312,151,381165,026,1127.36-6.67436007.17-41
October 270612,210,155167,055,6127.31-0.05436007.17+0
April 271016,782,697166,217,56710.10+2.79586009.67+15

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the United Land Movement.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373

BillCreatedVoting startedVoteBill StatusResult
PSFVP further free market reformsAugust 2500August 2500passed
Conspicious Religion Bill (2500)May 2500May 2500defeated
OOC: Cultures and Regional InfluenceApril 2500June 2517passed
PSFVP Eminent Domain BillApril 2500April 2500passed
PSFVP Buisness Failure BillApril 2500April 2500defeated
PSFVP Civil Defence BIllApril 2500April 2500passed
DSP.007.2500 (Cabinet Discussion)March 2500June 2502passed
MottoMarch 2500March 2500defeated
DSP.008.2500 (Motto)March 2500March 2500defeated
DSP.006.2500January 2500January 2500defeated
DSP.005.2500January 2500January 2500defeated
PSFVP overseas Ownership BillJanuary 2500January 2500passed
OOC: Civil War InfoDecember 2499July 2511passed
Cabinet Proposal of 2499 (DSP.004.2499)December 2499December 2499defeated
PSFVP moderated foriegn policy BillNovember 2499November 2499defeated
HDLP Freedom of Business And Abolishment of the Welfare State BillNovember 2499November 2499defeated
Provisional Government billOctober 2499October 2499defeated
Undarro Political Awareness BillOctober 2499October 2499passed
PSFVP Buisness Ownership BillSeptember 2499September 2499passed
DSP.003.2499 (Economic Compromise)August 2499April 2505passed

Random fact: Players have a responsibility to make a reasonable effort to be accurate when communicating the rules to other players. Any player who manipulatively misleads another player about the rules will be subject to sanction.

Random quote: "I bet their mothers don't love them. Many Trigunian women are so cold. I mean it's a racist hellhole in parts." - Tirza Sommer, former Dorvish politician

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51