Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: June 5563
Next month in: 03:33:26
Server time: 00:26:33, November 01, 2024 CET
Currently online (3): AR Drax | JourneyKan | Luna11 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


The Freedom Party[?]

This page contains information about the The Freedom Party.

This party is inactive.

Details

User[?]: Dr. N.C. Curtis

Nation[?]: Democratic Republic of Talmoria (Talmoria)

Seats[?] in National Assembly[?]: 0

Color[?]:

 

Description[?]:

A government must not interfere with a citizen's personal life more than what common sense provides for.

Current Leadership:
Party Chairman- Jack Pearson
Vice-Chairman- Vice President Bill Goulding

Government Officials:
President: Jesse Wishmaster
Vice-President: Cary Hilton
Assembly Minority Leader: Donald Francis
Assembly Minority WHIP: Jessica Warren

Founded by revolutionaries trying to overthrow the Radical Feminists regime in the early 3300's.

Executive History:

Dr. Nathan Britt (3313-3325, 3337-3339)
VP: Allen Spalding (3313-3317)
VP: Stephen Lowell (3317-3325)
VP: Washington Jeckyll (3337-3339)

Terry McDonnell (3325-3333)
VP: Redd Kennedy (3325-3326)
VP: Romain Davis (3326-3333)

Gen. Perry Sampson (3333-3337)
VP: Harry Wallace (3333-3337)

Dr. Washington Jeckyll (3347-3355)
VP:Bill Goulding (3347-3355)

Jesse Wishmaster (3355-)
VP: Cary Hilton (3355-)

Party Chairmen:
Romain Davis (3313-3326)
Dr. Nathan Britt (3326-3333)
Terry Ashcraft (3333-3340)
Terry McDonnell (3340-3349)
Tommy Bingham (3349-3355)
Jack Pearson (3355-)

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightsrestrictive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketregulator-leaningmoderateperfect
Militarymoderate militaristlimitedperfect
Moralityconservative-leaningmoderateperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
April 330347,23054,346,5480.09+0.0901000.00+0
October 330648,20250,285,9820.10+0.0101000.00+0
June 330912,079,67212,118,62999.68+99.58100100100.00+100
June 331111,871,20911,894,91399.80+0.12100100100.00+0
January 331311,658,73911,658,739100.00+0.20100100100.00+0
January 331734,259,90346,894,90173.06-26.9435650071.20+256
January 332132,509,00262,556,65451.97-21.0925950051.80-97
January 332532,020,77849,943,05264.11+12.1531850063.60+59
January 332932,398,21149,223,80665.82+1.7031950063.80+1
January 333329,787,43847,303,32562.97-2.856010060.00-259
January 333738,762,88961,632,97562.89-0.086210062.00+2
June 334335,871,58060,701,46459.10-3.805710057.00-5
June 334735,842,64562,065,44057.75-1.355710057.00+0
June 335127,447,30844,225,62262.06+4.315610056.00-1
June 33557,556,64722,599,51133.44-28.624410044.00-12

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the The Freedom Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261

BillCreatedVoting startedVoteBill StatusResult
Cabinet Proposal of December 4407December 4407December 4407passed
World Congress Budget Office Approval ActJune 4407December 4407passed
Ratification of the Global Emancipation TreatyJuly 4406June 4407defeated
Expanding Morality And Faith ActFebruary 4405October 4405passed
Energy Competition ActNovember 4404May 4405passed
Agribusiness Regulation and Reform ActOctober 4404February 4405defeated
Innovation in Defense Industry ActOctober 4404February 4405defeated
Ending Forced Military Service ActAugust 4404February 4405passed
New Order Reforms: Social SecurityJune 4404December 4413passed
Sensible Animal Regulation ActMay 4404November 4404passed
Higher Education Reform ActApril 4404November 4404defeated
Cabinet Proposal of April 4404April 4404April 4404passed
Expanding Internet Access ActNovember 4401April 4404defeated
ID Privacy Protection ActNovember 4401April 4404passed
Eminent Domain Reform ActNovember 4401February 4404defeated
Private Religious Freedom ActNovember 4401February 4404defeated
Tax Cut ActNovember 4401May 4402passed
Talmorian Labor Reform ActNovember 4400November 4400passed
Cabinet Proposal of March 4400March 4400March 4400passed
Historical and Cultural Preservation ActNovember 4399November 4399passed

Random fact: Discuss flag designs at the Flag Designs thread: http://forum.particracy.net/viewtopic.php?f=5&t=37

Random quote: "Benefits should be conferred gradually; and in that way they will taste better." - Niccolo Machiavelli

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51