Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: May 5475
Next month in: 03:20:30
Server time: 08:39:29, April 26, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Partidul Poporului Noului Endralon[?]

This page contains information about the Partidul Poporului Noului Endralon.

This party is inactive.

Details

User[?]: Autokrator15

Nation[?]: Újndrálon és Kizénia Egyesült Királysága | Regatul Unit al Noului Endralon și Chizânâ (New Endralon and Kizenia)

Seats[?] in Royal Parliament | Királyi Parlament | Parlamentul Regal[?]: 0

Color[?]:

 

Description[?]:

New Endralonian People's Party (Luthorian)
Partidul Poporului Noului Endralon (Kizenian)
Új Endralonai Néppárt (Zyldavian)
Abbriviation: NEPP
--------------------

The New Endralonian People's Party (NEPP) is a Conservative and a Nationalist party which was founded to protect and serve the New Endralonian people living in New Endralon / Kizenia. During the time of its foundation a very old and very big feud was being fought out by the three ethnicities of this nation. The Kizenians at the time dominated all of the nation.

After participating in the long feud, the NEPP and two other parties banded together to create the Confederation. All ethnicities would get their own autonomous nation within it. Thus the Confederation of New Endralon, Kizenia and Kuzaki was born. Now the NEPP champions to maintain the fragile peace and keep the Confederation together.

-------------------------------------

Ideology:

- New Endralonian / Zyldav Nationalism
- Neoconservatism
- Conservatism
- Liberal Conservatism
- Classical-liberalism
- Libertarianism
- Hosian Democracy

-------------------------------------

Manifesto:

- Lower taxes, especially for the higher and middle income. The NEPP prefers a flattax rate so that all pay their share but aucces wont be punished. Corporation taxes should be minimal to keep big companies here.

- Free Market economics, lowing the amount of regulation to ensure evonomic growth and keeping the states meddling hands out of people's affairs. The free market allocates goods and services the best.

- Strong Military, our armed forces need updating and we need them to be strong to defend us in the face of war. The NEPP is proud of our soldiers.

- Family Values, traditional values is what keeps us strong, united and cared for. Youthful individualism is dangerous and leads to a society where we ignore one another.

- Small Government, the government is a neccessary evil created to serve the people not to make them slaves. Our party stands for freedom and liberty from government tyrrany.

- Solid Finances, the government cannot be trusted with alot and one thing it should be checked on is its finances. We oppose creating debt or budget deficits. Solid finances keeps our economy healthy.


-------------------------------------

Leaders:
* Konstantijn Zyldavianus (3487-3502) (15 years)
* Alexander Desländ (3502-3510) (8 years)
* William van Lücbrück (3510-3528) (18 years)
* Magnus Hesselboe (3551-3572) (21 years)
* Alexander Hesselboe (3572-3581) ( 9 years)
* George Howard Farragius (3581-3603) (22 years)
* Howard Farragius (3603-3610)
* George Walker Farragius (3712-3715)
* Nikolas József Farragius (3960- 3976)
* Artur Oszkár Farragius (3976-4000)

-------------------------------------

Coalition participation:

BP-NEPP - 3487-3490 (3 years)
NEPP-ZNP - 3490-3510 (20 years)
NEPP-LDP-ZNP - 3522-3523 (1 years)
NEPP-LDP-ZNP-CoG - 3523-3528 (5 years)
NEPP-DP - 3551-3556 (5 years)
CDU-NEPP-ZNP - 3559-3562 (3 years)
NEPP-CDU-KLP - 3562-3565 (3 years)
NEPP-ZNP-KLP - 3565-3566 (1 year)
ZNP-NEPP-KCP - 3572-3592 (20 years)
NEPP-KCP-ZNP - 3599-3600 (1 year)
NEPP - 3712-3715 (3 years)
NEPP - 3960-4042 (82 years)
NEPP - 4063-4069 (6 years)
NEPP-KLS - 4069-4075 (6 years)
NEPP - 4087- 4110 (23 years)
PSD-NEPP-UHD - 4110-4113 (3 years)
NEPP-PNC-DLP-PNA - 4113-4116 (3 years)
A-NEPP-UHD - 4120-4125 (5 years)
NEPP - 4136-4155 (19 years)
PSP-NEPP - 4163 -
NEPP-AaL - 4302- Present
---------------------------------------

Prime-Ministers:

* Konstantijn Zyldavianus (3490-3493) (3 years)
* William van Lücbrück (3522-3528) (6 years)
* Abraham Smith-Locke (3551-3556) (5 years)
* Neville Churchill (3562-3566) (4 years)
* Jebediah Hesselboe (3599-3600) (1 year)
* Winston Hesselboe (3712 - 3715) (3 years)
* Artur Oszkár Farragius (3960-3976) (16 years)
* General Mátyás Farragius (3976-4000) (24 years)

---------------------------------------

Presidents:

* George Farragius (3492-3516) (24 years)
* George Walker Farragius (3516-3528) (12 years)
* Magnus Hesselboe (3559-3569) (3571-3576) (15 years)
* George Howard Farragius (3589-3595) (6 years)
* George Walker Farragius (3711 - 3722 (11 years)
* Nikolas József Farragius (3960-3976) (16 years)
* Artur Oszkár Farragius (3976-4000) (24 years)
* General Mátyás Farragius (4000-4012) (12 years)
* Márton Lakatos (4012-4028) (16 years)
* Mátyás Farragius (4028-4034) (6 years)
* Izsák Lakatos (4034-4038) (4039-4042) (7 years)
* Mikael Hunyadi (4063-4075) (12 years)
* Mátyás Lakatos (4087-4099) (12 years)
* Jakab Hunyadi (4099-4107) (8 years)
* Józef Henrik Madaras (4107-4109) (2 years)
* Henrik Hunyad (4113-4116) (3 years)

---------------------------------------

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsmoderate permissivelimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsunknownclose to noneperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketmoderate laissez-fairemoderateperfect
Militaryconvinced militaristlimitedperfect
Moralityconservative-leaningmoderateperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
June 348814,074,66256,685,13024.83+24.8311245024.89+112
March 348913,422,16957,274,35123.43-1.3910345022.89-9
September 349016,063,46453,525,94330.01+6.5813245029.33+29
June 349224,919,53358,755,28642.41+12.4019345042.89+61
February 349833,158,36760,959,14454.39+11.9827250154.29+79
February 350420,629,56139,014,56052.88-1.5226050151.90-12
February 351015,017,12757,224,69626.24-26.6313150126.15-129
February 351617,856,18258,909,06930.31+4.0713445029.78+3
February 352223,570,21063,391,78037.18+6.8717045037.78+36
November 352417,843,25163,147,94428.26-8.9312945028.67-41
May 355120,407,68355,445,68336.81+8.5516445036.44+35
May 35558,230,11261,232,62813.44-23.376045013.33-104
May 355912,869,47760,787,10821.17+7.739845021.78+38
July 356115,988,94657,622,97227.75+6.5812345027.33+25
July 356514,138,29059,014,75223.96-3.7910745023.78-16
July 356917,483,34662,230,80228.09+4.1412645028.00+19
December 357117,305,67160,694,92028.51+0.4212945028.67+3
December 357517,125,55659,703,12528.68+0.1712945028.67+0
October 357715,061,32260,134,87025.05-3.6411345025.11-16
October 358111,991,09151,227,23223.41-1.6410545023.33-8
October 358514,016,98652,189,04826.86+3.4512145026.89+16
October 35893,900,94338,072,41710.25-16.614745010.44-74
February 35914,103,87233,581,41012.22+1.975645012.44+9
February 359513,250,47551,340,87125.81+13.5911645025.78+60
February 359913,366,71150,762,10426.33+0.5211345025.11-3
February 360315,092,23252,809,38928.58+2.2512445027.56+11
February 360714,850,50555,532,58026.74-1.8411945026.44-5
January 362318,722,61058,874,68231.80+5.0614345031.78+24
January 362714,168,48762,388,06322.71-9.0910145022.44-42
January 363112,651,51355,975,88122.60-0.1110145022.44+0
January 363518,687,29053,298,66135.06+12.4615645034.67+55
December 371134,669,91658,605,18759.16+24.1026845059.56+112
December 371526,562,20260,422,75143.96-15.2019945044.22-69
December 371921,120,20357,176,77036.94-7.0216745037.11-32
July 396011,534,11711,534,117100.00+63.06555555100.00+388
February 396311,919,62111,919,621100.00+0.00451451100.00-104
February 396711,323,03715,951,48470.98-29.0237345182.71-78
September 396812,317,66312,317,663100.00+29.02451451100.00+78
September 397211,634,08711,634,087100.00+0.00451451100.00+0
June 397611,876,52811,876,528100.00+0.00451451100.00+0
June 398010,948,84810,948,848100.00+0.00451451100.00+0
June 398411,882,34111,882,341100.00+0.00451451100.00+0
June 398812,531,47112,531,471100.00+0.00451451100.00+0
June 399211,888,25911,888,259100.00+0.00451451100.00+0
June 399657,479,11657,528,34799.91-0.09451451100.00+0
June 400023,753,82539,032,19160.86-39.0626545158.76-186
June 400434,701,63153,338,79865.06+4.2028845163.86+23
June 400831,318,70750,231,11262.35-2.7127145160.09-17
June 401226,865,93651,637,78852.03-10.3223345151.66-38
June 401628,702,81649,793,48557.64+5.6225845157.21+25
June 402032,435,17551,055,24063.53+5.8928645163.41+28
June 402420,663,72439,087,83952.86-10.6624045153.22-46
June 402828,001,52052,481,40253.36+0.4923745152.55-3
June 403212,438,99212,438,992100.00+46.64451451100.00+214
July 403412,300,81812,300,818100.00+0.00451451100.00+0
February 403827,008,22630,492,95188.57-11.4337945184.04-72
March 403835,857,78152,814,89167.89-20.6830245166.96-77
March 404224,787,27055,864,89744.37-23.5220145144.57-101
March 404627,856,06857,738,86748.24+3.8721845148.34+17
March 405025,622,19853,145,53748.21-0.0321045146.56-8
March 405424,362,16452,359,34346.53-1.6820445145.23-6
March 405825,549,98452,273,64448.88+2.3522345149.45+19
August 406327,993,73147,153,43459.37+10.4926645158.98+43
April 406920,355,56359,254,38234.35-25.0115245133.70-114
February 407521,140,70456,751,69637.25+2.9016545136.59+13
February 408121,014,67752,519,63440.01+2.7617745139.25+12
February 408726,287,51933,466,05078.55+38.5434645176.72+169
August 408712,274,08712,399,97798.98+20.4344845199.33+102
August 409111,843,06411,843,064100.00+1.02451451100.00+3
August 409511,702,64911,702,649100.00+0.00451451100.00+0
August 409911,410,01011,410,010100.00+0.00451451100.00+0
August 410311,711,54811,711,548100.00+0.00451451100.00+0
August 410711,968,36511,968,365100.00+0.00451451100.00+0
May 410913,572,06862,789,69321.62-78.3810045122.17-351
January 411012,058,49662,333,15319.35-2.278645119.07-14
June 41139,851,03460,289,69816.34-3.019760116.14+11
January 41169,808,90961,573,63015.93-0.419760116.14+0
August 411812,528,20763,681,53119.67+3.7412060119.97+23
December 411911,275,44363,330,23517.80-1.8710660117.64-14
December 412212,270,85665,850,01818.63+0.8311360118.80+7
December 412414,954,83865,181,49422.94+4.3113660122.63+23
December 412614,806,44362,873,76223.55+0.6113760122.80+1
December 412925,399,46763,403,88340.06+16.5123960139.77+102
July 413223,650,44257,035,97141.47+1.4124560140.77+6
July 413523,641,23554,527,01843.36+1.8925360142.10+8
May 413612,014,00712,014,007100.00+56.64601601100.00+348
May 414011,597,18411,597,184100.00+0.00451451100.00-150
May 414447,641,14553,339,74289.32-10.6840245189.14-49
May 414811,824,97011,824,970100.00+10.68451451100.00+49
May 415263,064,45763,103,68699.94-0.06451451100.00+0
May 415518,311,50357,792,63031.68-68.2514245131.49-309
May 415914,868,88556,610,99626.27-5.4211845126.16-24
May 416316,657,83255,224,79330.16+3.9013745130.38+19
May 416714,562,35957,970,00225.12-5.0411345125.06-24
May 417118,675,60559,490,73331.39+6.2714345131.71+30
January 417314,156,94857,208,22524.75-6.6511245124.83-31
February 417616,618,71555,308,62330.05+5.3013545129.93+23
February 418016,401,39658,425,14928.07-1.9712545127.72-10
February 418417,355,84457,107,89430.39+2.3213445129.71+9
April 418525,460,22752,596,63648.41+18.0221745148.12+83
October 430013,805,98057,993,90623.81-24.602410123.76-193
June 430415,898,21655,334,52328.73+4.938730128.90+63
June 430815,177,78254,791,06927.70-1.038430127.91-3
March 431116,525,55039,777,94541.54+13.8412630141.86+42
March 446512,259,07353,636,57422.86-18.6914060023.33+14
January 526111,869,86911,869,869100.00+77.14750750100.00+610
February 526612,123,49612,123,496100.00+0.00501501100.00-249
August 526611,744,63611,744,636100.00+0.00501501100.00+0
August 527212,187,22612,187,226100.00+0.00501501100.00+0
August 527811,513,86711,513,867100.00+0.00501501100.00+0
August 528412,093,04212,093,042100.00+0.00501501100.00+0

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Partidul Poporului Noului Endralon.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384

BillCreatedVoting startedVoteBill StatusResult
Liberal Conservative Party CoupJune 4447June 4448defeated
RP: Prevention of Threats to National Security Act (New Players, Please Read)May 4447March 4462nodefeatedwon
Prevention of Threats to National Security ActFebruary 4447May 4447passed
Torture ActFebruary 4447February 4447defeated
Civil Liberties (Enhancement) ActFebruary 4447February 4447passed
Infrastructure Enhancement (Highway Projects Policy) Amendment ActFebruary 4447February 4447passed
Right To Strike ActFebruary 4447February 4447defeated
Multiple Citizenship ActFebruary 4447February 4447defeated
RP: National Framework For Tripartism (New Players, Please Read)January 4447March 4462nodefeatedwon
Central Bank ActJanuary 4447June 4447defeated
National Framework For Tripartism ActJanuary 4447February 4447passed
Ecology BillDecember 4446June 4447defeated
Religious Clothing ActDecember 4446June 4447passed
Termination of Pregnancy ActDecember 4446June 4447defeated
Treatment of Prisoners of War BillDecember 4446February 4447defeated
Domestic Agriculture (Support & Protection) ActDecember 4446February 4447passed
Monuments & Places of National Importance ActDecember 4446February 4447passed
Infrastructure Enhancement (Eminent Domain Package) ActDecember 4446February 4447passed
Budget proposal of December 4446December 4446December 4446passed
Income tax proposal of December 4446December 4446December 4446passed

Random fact: Discuss flag designs at the Flag Designs thread: http://forum.particracy.net/viewtopic.php?f=5&t=37

Random quote: "It only takes 20 years for a liberal to become a conservative without changing a single idea." - Robert Anton Wilson

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51