Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: July 5504
Next month in: 03:38:40
Server time: 16:21:19, June 25, 2024 CET
Currently online (5): Ancom | Arbitio | EstGuyOnceMore | SocDemDundorfian | thedragonofeden | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Liberty Party[?]

This page contains information about the Liberty Party.

This party is inactive.

Details

User[?]: sthammer

Nation[?]: Hobratsuri Respublika (Hobrazia)

Seats[?] in Erovnuli Asamblea (National Assembly) [?]: 0

Color[?]:

 

Description[?]:

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristmoderateperfect
Civil Rightspermissive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketmoderate laissez-fairemoderateperfect
Militarymoderate militaristmoderateperfect
Moralityconservative-leaninghighperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
April 375841,80462,916,1750.07+0.0703250.00+0
April 376112,378,51445,301,48027.32+27.2611040027.50+110
April 376413,778,45351,781,40126.61-0.7211040027.50+0
April 376712,763,14452,549,56524.29-2.3210040025.00-10

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Liberty Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348

BillCreatedVoting startedVoteBill StatusResult
L-PU Call for early elections, July 2112, after the current bills go throughJuly 2112July 2112passed
Treaty of Non-aggression Between the Republic of Hobrazia and the Selucian Empire.December 2111December 2111passed
Repeal of Eminent Domain.December 2111December 2111defeated
Fishing Industry ProposalNovember 2111November 2111passed
Nuclear-Free Hobrazia Act 2109May 2111May 2111defeated
Cabinet Wars 2110 - A USM ProposalDecember 2110December 2110defeated
United Blobs Revised Cabinet Proposal of June 2110June 2110June 2110passed
United Blobs Draft Cabinet Proposal of May 2110June 2110June 2110passed
Wartime Military Act.June 2110June 2110passed
Pharmaceutical Drugs Act, Research and Development.June 2110June 2110passed
L-PU Cabinet Proposal of May 2110May 2110May 2110defeated
National History Museum Proposal.April 2110April 2110passed
Worker's Expression Freedom ActJune 2109June 2109defeated
Prisoner Work ActJune 2109June 2109passed
Patient's Rights Act 2109May 2109May 2109defeated
Pharmaceutical Drugs ActMay 2109May 2109passed
Fair Tax Act of 2109.May 2109May 2109passed
Private Armaments ActDecember 2108December 2108passed
Education for All Hobrazians ActFebruary 2108February 2108defeated
Cabinet Proposal of October 2107 - A compromise and balance of powerDecember 2107December 2107passed

Random fact: If you are likely to be logging in to Particracy with the same IP address as another player with an active account, please inform Moderation on the forum. Otherwise your account could be inactivated on suspicion of multi-accounting.

Random quote: "In politics, madame, you need two things: friends, but above all an enemy." - Brian Mulroney

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 52